KEGG   Hyperthermus butylicus: Hbut_0593Help
Entry
Hbut_0593         CDS       T00468                                 

Definition
(GenBank) hypothetical protein
Organism
hbu  Hyperthermus butylicus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABM80453
UniProt: A2BKE2
Position
complement(561787..562170)
Genome map
AA seq 127 aa AA seqDB search
MAEERITGRGGYGAVNPSELLEALRLGFDDMEAYAYMAGGDVVLRVEYELLVLRVPRHLL
YWDLTAYLRRLGSEVAQCGHTIYFTYNAYGLRIVYQARIIHIHRGNAYLAVAPRHVGKMP
RCGQELE
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
ttggccgaggagaggattacgggtagaggggggtatggagctgtaaacccctccgagctg
ctcgaagccctcagactaggatttgacgatatggaagcatacgcctacatggctggaggc
gatgtggtcctacgcgtcgagtatgaactcctggttctcagggtgccacgccatctcctc
tactgggatctaaccgcctatcttaggagactcggctctgaagttgcacaatgcggacac
accatatacttcacctacaatgcgtacgggctaaggatagtataccaggcccgcataatc
cacatccaccgcgggaatgcttatctcgcagtagcaccacgccacgtaggcaaaatgcca
agatgtggccaggagctagagtag

DBGET integrated database retrieval system