KEGG   Hyperthermus butylicus: Hbut_0600Help
Entry
Hbut_0600         CDS       T00468                                 

Definition
(GenBank) predicted Acetyltransferase
Organism
hbu  Hyperthermus butylicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FR47 Acetyltransf_1 Acetyltransf_10 GNAT_acetyltran Acetyltransf_7 Acetyltransf_CG Acetyltransf_9 Acetyltransf_15
Motif
Other DBs
NCBI-ProteinID: ABM80459
UniProt: A2BKE8
Position
complement(572167..572760)
Genome map
AA seq 197 aa AA seqDB search
MNSLLQRLSDKYGSIIVQLHGSSTRLSWGFKAVLEHNGYNARGKTYIDMAIDSPRLFKPY
HAPGVRVVELGEQHAADYAEVEATRGRKLSPEEASRLLRTLGCYGAYVEGVLASIACTYI
RMHDIWLIGNVYTRPEYRGRGLAKAVTSTVTARALACGAKPLLHVEAGNKPAIRVYARLG
YRALRARPWIFAHRATL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
ttgaactcccttctccagaggcttagcgacaagtatggaagtatcattgtgcagcttcac
ggctcctcgacaaggctcagctggggcttcaaggctgtactcgagcacaacggctacaat
gccagggggaaaacctatattgacatggccatagactcgcccagactcttcaagccctac
catgccccgggcgtacgcgtggtagagcttggggagcagcatgcagcagactatgcagag
gttgaggccacccgtggcaggaagctaagccccgaagaggcctcgaggctgctcagaact
ctgggctgctatggcgcctacgtcgagggcgttctagcctccatagcatgtacatacatc
cggatgcacgatatatggctcataggcaacgtctacacgaggccggaataccgtggacga
ggcttagcaaaggccgtcacgagtacggttacggctagagccctagcctgtggtgctaag
cccctgctgcatgttgaggcaggcaacaagccagccataagggtctatgcgcggctcggc
tatagagccctaagagctagaccgtggatattcgcgcatcgggccacgctgtaa

DBGET integrated database retrieval system