KEGG   Hyperthermus butylicus: Hbut_0610Help
Entry
Hbut_0610         CDS       T00468                                 

Definition
(GenBank) universally conserved protein
Organism
hbu  Hyperthermus butylicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Usp DUF724
Motif
Other DBs
NCBI-ProteinID: ABM80469
UniProt: A2BKF8
Position
complement(583263..584147)
Genome map
AA seq 294 aa AA seqDB search
MQIRDSGWRFATALVGLDMSPSSDVLVEWLPNLRLLGTTTLILLHVVPEHIVAELLAGIV
SVDKVVEEQRRKALGKLAEYASMLERYGFEVEVPRPKIGNPAGWIVRASEAYGADYIVLG
SRGHGLLRELLLGSVVEEVLHASRKPLLIARIRRSPDGEPVQPPPLKGTVVAAIDFNLYL
EDVYTCSVEVAEHTGNPLTLLHVLEPGEDPILARERLEKLAEKARHRGLAVNTRLLEGKP
GKRIIEEAARLDAALIIVGPGLSRTSPIGATTETVVRRAQTNVLVCRRAPAVQE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcagataagggattctggatggaggtttgctacagcgctcgttggtctagacatgtct
ccatcgtctgacgtgcttgtagagtggcttccaaacctgagactcctcggcacaacaaca
cttatacttctccatgtcgtgccagagcacattgtggcagaacttttggctgggatagtg
tctgttgacaaggttgttgaggagcagaggaggaaggcgttggggaaacttgcagagtat
gcaagcatgctggagcgctacgggtttgaggtggaggtgccgaggcccaagattggcaac
ccagctggatggatagtgagagcctccgaggcatacggcgcggactacatagtgctaggc
tcccgaggccatggcctcctccgcgaactgctactgggcagtgttgtcgaggaggtactc
cacgcgtcacgtaaacctctgctcatagcaaggatacggaggagcccggacggcgagcca
gtacagccacccccgctcaagggcaccgttgtagcagccatagacttcaatctctaccta
gaagacgtgtatacatgctcggtagaggttgctgagcatacagggaatcctcttacactg
ctacatgtactcgagccaggcgaagaccccatcctcgcaagggagaggctggagaagctt
gcagagaaagcgagacaccgtggcctagctgtgaacactagactcctcgaagggaagccc
ggtaaacggataatagaggaggcagcaaggctagacgctgcactaatcattgtcggccca
ggtttgagccgcacatcaccgataggagctacgacagagactgtggtgcgtagggctcag
acaaacgtgctagtttgtcgcagagcacccgcagtccaagagtaa

DBGET integrated database retrieval system