KEGG   Hyperthermus butylicus: Hbut_0614Help
Entry
Hbut_0614         CDS       T00468                                 

Definition
(GenBank) High-affinity branched-chain amino acid transport ATP-binding protein
  KO
K01995  branched-chain amino acid transport system ATP-binding protein
Organism
hbu  Hyperthermus butylicus
Pathway
hbu02010  ABC transporters
hbu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:hbu00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Hbut_0614
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Hbut_0614
Transporters [BR:hbu02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    Hbut_0614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 BCA_ABC_TP_C SMC_N AAA_29 AAA_25 AAA_23 T2SSE AAA_22 AAA_30 SRP54 AAA_16 AAA NB-ARC DLIC AAA_15
Motif
Other DBs
NCBI-ProteinID: ABM80473
UniProt: A2BKG2
Position
complement(588883..589662)
Genome map
AA seq 259 aa AA seqDB search
MKGGYDFDKYILVVEDLYKYFGGIRAVDGVSLRVPRRSIIGLIGPNGSGKTTLFNVVAGL
YKPDKGRIIFDGVDIAGRKPHEIYKLGLIRTFQNPRLWTSLTVFENVLGAAENRKGENIA
GALFQRLWEGQERKLAGEALDWIDFVELSSVDHMLPLNISGGQMKLAELARALMARAKLL
LLDEPSAGVNPTLARRIFEGIERLRSEYGLTFLIIEHRLEILFDFVDYVYVMHRGKIVAE
GKPEEVAENPVVLDIYLGG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaagggaggctacgactttgacaaatacatattggttgttgaggacctctacaagtac
tttggcggcatacgtgcagtagacggtgtaagccttagagtgccgcgtcgcagcataatt
ggcctcataggccccaatggtagtggtaagacgacattattcaatgttgtggctggattg
tacaagcccgacaagggccgcataatcttcgacggagtcgacatagcgggtaggaagcca
catgagatatacaagttggggcttataaggacatttcagaatccaaggctatggacgagc
ctaacagtgttcgagaacgtgctaggcgctgccgagaaccggaaaggcgagaacattgca
ggagcgcttttccagaggctctgggaggggcaggagagaaagctggcaggagaagcacta
gactggatagacttcgtcgagctgtccagcgtggatcacatgctccccctaaacatcagc
ggaggacagatgaagctagcggagcttgcacgcgccctaatggcgcgtgctaaactactc
ttactagacgagccatctgccggcgtgaatcccaccctggccaggaggatattcgagggg
atagagaggctgagaagcgagtacgggctaaccttcctaataatcgagcacaggctggag
atacttttcgacttcgtcgactacgtgtacgtaatgcaccgtggcaagatagttgccgag
ggcaaaccggaggaggttgctgagaacccggtcgtgctagacatttaccttggagggtga

DBGET integrated database retrieval system