KEGG   Hyperthermus butylicus: Hbut_0616Help
Entry
Hbut_0616         CDS       T00468                                 

Definition
(GenBank) ABC-type branched-chain amino acid transport, periplasmic component
  KO
K01999  
branched-chain amino acid transport system substrate-binding protein
Organism
hbu  Hyperthermus butylicus
Pathway
ABC transporters
Quorum sensing
Brite
KEGG Orthology (KO) [BR:hbu00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Hbut_0616
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Hbut_0616
Transporters [BR:hbu02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    Hbut_0616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
592039..593364
Genome map
AA seq 441 aa AA seqDB search
MKGFRAISIYVVVGLLILGLLVGLAVGYFIGGGGGESKSATSTPAFNESSSVNFTAAGGG
LQGEIPIGILLPQTGSLAQDGRDNIKAAKLAIEDFNKLLESIGAPFRFKAIVADSGTDPN
KALAALQTLYNQHHVQIVVGTDSSWVLSGVMSFANEHHIVMISPASTSPALALKDYIFRI
VGNDKGQGKALAALVHNNGFNAAVVIFRDEAYGRGIAEAFKENFEALGGTAVLVPYNPQK
SDYAPEVQKLASEVEKLLNEGKNVAVIIVAFETDGINILSHAADIPVLSQVKWFASESIR
SPALLKAPDKVRQFLAKVELEGTFPIPPKSPLGEWFEKHFEEVYGHPPESPFSPYAYDAA
YLACLAVTIAGKYDGTVIAKVLPEVAKNYYGVTGWKLLDENGDLKYQEYSIWKYVCEGGS
CEFIDIAIYDPQSGKIQQIAG
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggatttagagcaatctcaatatatgttgttgtgggcctgctaatactgggcctg
ctagtaggcctagcagtaggctactttattggtggcggcggcggtgagagtaagtcagct
actagtacaccagccttcaacgaaagctcaagcgtaaactttactgctgcaggaggcggc
cttcagggcgagatacctatcggcatattgctcccgcagacgggaagcttggcgcaggat
ggaagggacaatattaaggctgccaagctggcaatagaagactttaacaagctactagag
tcgataggtgctccattccgctttaaggctatagttgctgatagtggtactgaccccaat
aaggcgcttgcagcactacagacactctacaaccagcaccacgtacagattgtcgtgggt
actgatagcagctgggtgctaagcggcgtaatgagctttgccaacgagcaccacatagtc
atgataagcccagccagtacgagccctgcgctagcactgaaggactacatattcaggatc
gttggcaacgataagggtcagggtaaggcgctagcagcactagttcacaataatgggttc
aacgctgctgtcgtgatattcagagacgaagcttatggccgtggcatagctgaggcattc
aaggagaactttgaagccttgggtggtacagcggtcctagtaccgtataacccacagaag
agcgactatgctccagaggttcagaagctagcatcggaggttgagaagctcctcaacgag
ggtaaaaatgttgcagttatcatcgtcgcgttcgaaacagacgggataaacatactgagc
catgcagccgatataccggtgctaagccaggtaaagtggtttgccagcgagtctatcagg
tcgccagcgctgctcaaggcccctgacaaggttagacagtttctagccaaggtggagctt
gagggtacattcccaataccgcccaagagcccgctaggtgaatggtttgaaaagcacttc
gaggaggtatacggccatccgccagagtctccgttctcgccatacgcttatgatgccgcc
tacctggcatgcctggctgtaaccattgcaggtaagtacgacggtacggtcatagctaag
gtgttgccggaggtggctaagaactactatggtgttacgggctggaagttgctagacgag
aatggtgacctcaagtaccaggagtacagcatctggaagtacgtctgcgaagggggatcc
tgcgagttcatcgatatcgccatatacgatccacaaagtggcaagatacagcagatagca
ggctag

DBGET integrated database retrieval system