KEGG   Hyperthermus butylicus: Hbut_0624Help
Entry
Hbut_0624         CDS       T00468                                 

Definition
(GenBank) conserved uncharacterized archaeal protein
Organism
hbu  Hyperthermus butylicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2139
Motif
Other DBs
NCBI-ProteinID: ABM80481
UniProt: A2BKH0
Position
complement(598930..600426)
Genome map
AA seq 498 aa AA seqDB search
MAGLDCILSKLELPSNSLSPEWGGGGVYGLLYHRGTLYYTLAFEAIAFFHHDDCETRIYR
FEHIGKPPRSGGDTYNASVAVDGTIYFGGWVHAPTDVLHTADGRSVISFTNKYSHVHAYD
TGERSVKLLWLEGGGDKRQWAGEVTDLLYNPSTDTLLAARGDGHFNLGVYEIDRRRGAAR
RASGKRVLRGTIYMDYACFTLHHGWGGRPGLHCINLDNYSQTVTVELDPVETYSVDGGGL
WGYRSGDIEAAYTKLYAAVKGGIIVFDPFGNEHVFVRMMDFHYNTYGPLRSNILPLAGGL
LVAFSAQSHATVRGTDELPEVQQKASQRPVAPSILVYISPPTARIVAALGVRITSMTLMG
SKVLIAGNTVPNLERYDATRIDYSRKSIVAFDAGRLLTNPPPPLVIELEGWIVDNKQFAG
IPLTGYRYAELEVKTNKTNRITVYTYTLNTPPGNADTDTYTLHPGKTRIDLTTHRSLITS
MRLEAPDPKARIRIILEP
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
gtggccgggctcgactgcatcctctcgaagctcgagctgccatccaatagcctctcccca
gaatggggaggcggtggggtctacggcctactataccaccgaggcaccctctactacacc
ctagcgtttgaagctatagcattcttccaccacgacgactgcgagacaagaatataccgt
ttcgagcacattggcaagccgccacgctccggcggcgacacctacaacgcctccgtggca
gtggatggcaccatatacttcgggggctgggttcacgcaccaaccgacgtactccacacc
gccgatggcaggtcggtaataagcttcacaaacaagtatagccatgtacacgcctacgat
acaggagagagaagcgtaaaactcctatggctcgagggcggtggcgataaacgccagtgg
gccggagaggttacagacctactctataacccaagcactgacaccctcctagcagcccgc
ggagacggacacttcaaccttggagtctacgagatcgatcggcggaggggcgctgcacgg
agagcatcagggaagcgcgtgctaagaggcacaatatacatggactatgcttgcttcaca
ctacaccacggctggggcggtaggcctggactacactgcataaaccttgacaactacagc
caaacggtaacggtagagctggatcccgttgaaacctatagcgttgatggcggcgggctc
tggggctaccggagcggcgacatagaagcagcctacacaaagctctacgccgcagttaag
ggcggaatcatagtcttcgaccccttcggcaacgaacacgtattcgttaggatgatggac
ttccactataatacctacgggcccttgagaagcaacattctaccactcgccggcgggcta
ctagtggcatttagtgcccagagccacgccacagtgaggggcaccgatgagctgccagag
gtgcagcagaaagcatcccagaggccggtagccccctcaatactcgtctacatatcccca
cccacagcaaggatagtggccgcgttgggagtaaggatcaccagtatgacgctgatgggt
tcaaaagtgctcatagcaggcaataccgtgccaaacctagagcgctacgatgcaaccaga
atagactacagccgcaaaagcatagttgcattcgacgctggcaggcttctcacgaaccca
cctccacccctagtaatcgagctagagggctggattgtcgacaacaaacagtttgcaggc
ataccgctaacaggttaccgttacgcagaactcgaagtaaaaaccaacaagacaaacagg
ataacggtctacacctacaccctcaacacgccaccaggcaatgccgatacggacacctac
acactacacccaggcaagacaaggatagacctaacgacacaccgcagcctcataacctca
atgaggctggaagcccccgacccgaaggcaaggataagaataatcctagaaccctag

DBGET integrated database retrieval system