KEGG   Hyperthermus butylicus: Hbut_0632Help
Entry
Hbut_0632         CDS       T00468                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hbu  Hyperthermus butylicus
Brite
Enzymes [BR:hbu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Hbut_0632 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
608941..609666
Genome map
AA seq 241 aa AA seqDB search
MAPWTRDEEWFREARRRLVERLVREGYIRSEHVKRAMLRVPRELFVPDELRHLAYEDTPL
PIGHGQTISAPHMVAMMTEYADLKPGMKVLEVGAGSGYHAAVMAEVVAPSDEPREHWGHV
YTIERIPELAEFARRNLERAGYADRVTVIVGDGSRGYPEKAPYDRIIVTAAAPDIPGPLI
DQLKPGGKMVIPIGDRYLQHLYVVVKTRDGKIESRPVTPCLFVPLVGEYGWREYEADTTL
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
ttggctccatggactagggatgaggagtggtttagagaggctcgccgccgacttgtagag
aggcttgtcagggagggatacataaggtcggagcatgtgaagagggccatgcttagagtg
ccacgggagctatttgtgccggacgagcttcgccacttggcctacgaggataccccgcta
ccaatagggcatgggcagacgatcagtgctccccacatggttgcaatgatgacagaatat
gcggacctaaaaccaggtatgaaggttttagaggttggcgcaggctcgggctaccatgca
gcagtaatggcggaggttgtagcgcctagcgatgagcctcgagagcattggggccacgta
tacacgattgagcgtataccggagctagcagagttcgcccggagaaacctggagcgggca
ggatatgctgaccgcgtcacagtcatagtaggcgatggctcgaggggctacccggagaag
gctccctacgacaggataatagtgacagcagcggcacccgacatccccggcccactcata
gaccagctcaagccgggaggcaaaatggtgataccaataggcgaccgctacctccaacac
ctctacgtggtggtgaagaccagggacggtaagatagaatccagaccggttacaccctgc
ctcttcgtcccactagtcggggagtacggctggagagagtacgaagccgacactactcta
gcctag

DBGET integrated database retrieval system