KEGG   Hyperthermus butylicus: Hbut_0632Help
Entry
Hbut_0632         CDS       T00468                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hbu  Hyperthermus butylicus
Brite
Enzymes [BR:hbu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Hbut_0632
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 GCD14 Methyltransf_24 Methyltransf_3 Methyltransf_25 Methyltransf_11 ACP_syn_III_C DUF938 CMAS Methyltransf_32 Methyltransf_23 Met_10 RrnaAD Fibrillarin
Motif
Other DBs
NCBI-ProteinID: ABM80489
UniProt: A2BKH8
Position
608941..609666
Genome map
AA seq 241 aa AA seqDB search
MAPWTRDEEWFREARRRLVERLVREGYIRSEHVKRAMLRVPRELFVPDELRHLAYEDTPL
PIGHGQTISAPHMVAMMTEYADLKPGMKVLEVGAGSGYHAAVMAEVVAPSDEPREHWGHV
YTIERIPELAEFARRNLERAGYADRVTVIVGDGSRGYPEKAPYDRIIVTAAAPDIPGPLI
DQLKPGGKMVIPIGDRYLQHLYVVVKTRDGKIESRPVTPCLFVPLVGEYGWREYEADTTL
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
ttggctccatggactagggatgaggagtggtttagagaggctcgccgccgacttgtagag
aggcttgtcagggagggatacataaggtcggagcatgtgaagagggccatgcttagagtg
ccacgggagctatttgtgccggacgagcttcgccacttggcctacgaggataccccgcta
ccaatagggcatgggcagacgatcagtgctccccacatggttgcaatgatgacagaatat
gcggacctaaaaccaggtatgaaggttttagaggttggcgcaggctcgggctaccatgca
gcagtaatggcggaggttgtagcgcctagcgatgagcctcgagagcattggggccacgta
tacacgattgagcgtataccggagctagcagagttcgcccggagaaacctggagcgggca
ggatatgctgaccgcgtcacagtcatagtaggcgatggctcgaggggctacccggagaag
gctccctacgacaggataatagtgacagcagcggcacccgacatccccggcccactcata
gaccagctcaagccgggaggcaaaatggtgataccaataggcgaccgctacctccaacac
ctctacgtggtggtgaagaccagggacggtaagatagaatccagaccggttacaccctgc
ctcttcgtcccactagtcggggagtacggctggagagagtacgaagccgacactactcta
gcctag

DBGET integrated database retrieval system