KEGG   Hyperthermus butylicus: Hbut_0667Help
Entry
Hbut_0667         CDS       T00468                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
hbu  Hyperthermus butylicus
Pathway
hbu00010  Glycolysis / Gluconeogenesis
hbu00020  Citrate cycle (TCA cycle)
hbu00620  Pyruvate metabolism
hbu00633  Nitrotoluene degradation
hbu00640  Propanoate metabolism
hbu00650  Butanoate metabolism
hbu00680  Methane metabolism
hbu00720  Carbon fixation pathways in prokaryotes
hbu01100  Metabolic pathways
hbu01120  Microbial metabolism in diverse environments
hbu01130  Biosynthesis of antibiotics
hbu01200  Carbon metabolism
Module
hbu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hbu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hbut_0667
   00020 Citrate cycle (TCA cycle)
    Hbut_0667
   00620 Pyruvate metabolism
    Hbut_0667
   00640 Propanoate metabolism
    Hbut_0667
   00650 Butanoate metabolism
    Hbut_0667
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Hbut_0667
   00680 Methane metabolism
    Hbut_0667
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Hbut_0667
Enzymes [BR:hbu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Hbut_0667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: ABM80523
UniProt: A2BKL2
Position
651032..651610
Genome map
AA seq 192 aa AA seqDB search
MPRVELRFHGRGGQGAVTAAKIVAAAAIMEGRYALAFPEYGAERRGAPVVAYTRIDEEPI
LEREPILEPDVVVVLDPSLDPKVYMSGLKSDGILVINTKKTLDQLSEYIGRAGFRPPRCI
ALVNATDIALKHLRAPIVNTAMLGSLIKAARVVSLDSVIEKVRETFGERPHVIEPNIRAI
EEAYNSTQVICS
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
ttgcctcgtgtcgagctacggttccatggcaggggcggtcagggtgcggtgacagctgca
aagattgttgctgctgccgcgatcatggagggccggtatgcgctggccttcccggagtat
ggtgctgagaggcgtggagcccccgtcgtcgcctacacgaggatcgacgaggagcctatt
ctcgagagagagccaatcctcgagcccgacgtagtcgtggtgctcgacccatccctagac
cccaaggtgtacatgtctgggctgaagagcgacggtatcctggtgatcaacacgaagaag
acgcttgaccagctaagtgaatacattggaagggctgggttccggccgccacgctgcata
gcgctggtgaacgctactgatatagcgttgaagcatctgcgcgcgccgattgtcaacacc
gcgatgctgggcagcctgataaaggcggctcgtgtcgtatcgctcgactctgttatcgag
aaggttagggagacgtttggcgagagaccccacgttattgaacccaatatccgggccata
gaggaggcctacaactcgacccaggtgatatgtagttga

DBGET integrated database retrieval system