KEGG   Hyperthermus butylicus: Hbut_0669Help
Entry
Hbut_0669         CDS       T00468                                 

Definition
(GenBank) pyruvate synthase subunit porA
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
hbu  Hyperthermus butylicus
Pathway
hbu00010  Glycolysis / Gluconeogenesis
hbu00020  Citrate cycle (TCA cycle)
hbu00620  Pyruvate metabolism
hbu00633  Nitrotoluene degradation
hbu00640  Propanoate metabolism
hbu00650  Butanoate metabolism
hbu00680  Methane metabolism
hbu00720  Carbon fixation pathways in prokaryotes
hbu01100  Metabolic pathways
hbu01120  Microbial metabolism in diverse environments
hbu01130  Biosynthesis of antibiotics
hbu01200  Carbon metabolism
Module
hbu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hbu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hbut_0669
   00020 Citrate cycle (TCA cycle)
    Hbut_0669
   00620 Pyruvate metabolism
    Hbut_0669
   00640 Propanoate metabolism
    Hbut_0669
   00650 Butanoate metabolism
    Hbut_0669
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Hbut_0669
   00680 Methane metabolism
    Hbut_0669
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Hbut_0669
Enzymes [BR:hbu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Hbut_0669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C ZnuA
Motif
Other DBs
NCBI-ProteinID: ABM80525
UniProt: A2BKL4
Position
651959..653215
Genome map
AA seq 418 aa AA seqDB search
MASAVETKPVEKELGKPHERIAATGGEAAAYAARDADIDVAAIYPITPQTPIAEKIAELV
ANGELDAELIHVESEHSAMSATIAAAATGARVFTATASQGLELMHEMLYIASSLRQPVVM
ALATRALSAPINIWNDYADAMSMRDTGWIMIFSENVQEVYDNMIQAYYIAEHPDVLLPVV
VTLDGFILSHTMEALELIPRDEVLAYAPKRPRSYRPVLDPDKPISIGVLGGPNWYYEAKI
QHVLALRESPRIIEEAARLFEKRFGRSYGFIEKYMMDDAEVAMVAMGATASLVKAAVKRL
RKEGVKAGMIKIRVYRPFPAEEIVKALENVKAVGVLNRAIAYGAPVEEPLFQDVVTALAV
RGIMKPMVSFVHGMGGRDIFVREIVDMYKKLLDAAREGKSVTRTLFWGVKNLEGKPYI
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtggcctcggcggttgagactaagcccgtggagaaggagctcgggaagcctcacgaacgc
atagccgccacgggaggcgaggctgcagcctacgctgccagggatgcagacatagacgtg
gctgcaatctacccgatcacgccacagacacccatcgcggagaagatagcagagctcgtg
gctaatggcgagctggacgcggagctgatacacgtcgagagcgagcacagcgccatgagc
gcaacaatagcagctgcagccaccggcgcaagggtgttcaccgccaccgctagccagggc
ctagagctgatgcacgaaatgctctacatagctagcagcctaagacagcccgtggtaatg
gccctcgctaccagagcgctaagcgccccgataaacatctggaacgactacgccgacgcg
atgagcatgagggatacaggctggataatgatcttcagcgagaacgtccaggaggtctac
gacaacatgatacaagcatactacatagctgaacaccccgacgtactcctacccgtggtg
gtaaccctcgacggcttcatactaagtcacacgatggaggccctcgagctgatacccagg
gacgaggtgctagcctacgccccgaagaggcctcgtagctaccgcccagtactagaccca
gacaagcccatatcaatcggcgtgctgggaggccccaactggtactacgaggcaaagata
cagcacgtcctagccctaagggagtccccgaggataatcgaggaggctgcgaggctgttc
gagaagcgtttcggcagaagctacggcttcatagagaagtacatgatggacgatgccgag
gtagctatggtagctatgggtgctacggcgagcctggtaaaggctgccgtgaagaggcta
aggaaggagggcgtaaaggctggcatgataaagatccgtgtatacaggccgttcccggca
gaggagatagtaaaggcgctcgagaacgtgaaggccgtcggcgtgctcaacagagcgata
gcgtacggcgctccagtcgaggagcccctattccaggacgtggtgacagcgctagccgtg
agggggataatgaagcctatggtgagcttcgtccatggtatgggtggcagggacatattc
gtgagggagatagtggacatgtacaagaagctcctcgacgccgcaagggagggcaagagt
gtgacccgcacactcttctggggcgtaaagaacctcgaaggcaaaccatacatctag

DBGET integrated database retrieval system