KEGG   Hyperthermus butylicus: Hbut_0729Help
Entry
Hbut_0729         CDS       T00468                                 

Definition
2-ketoisovalerate ferredoxin oxidoreductase subunit beta (EC:1.2.7.7)
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
hbu  Hyperthermus butylicus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hbu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hbut_0729
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hbut_0729
   00020 Citrate cycle (TCA cycle)
    Hbut_0729
   00620 Pyruvate metabolism
    Hbut_0729
   00640 Propanoate metabolism
    Hbut_0729
   00650 Butanoate metabolism
    Hbut_0729
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Hbut_0729
   00680 Methane metabolism
    Hbut_0729
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Hbut_0729
Enzymes [BR:hbu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Hbut_0729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(717130..718038)
Genome map
AA seq 302 aa AA seqDB search
MAVNLRTLPKKRYVLPGTAACPGCPEAMGLRFLGMALGEKAVLVVPAGCTSVIQGLGPKQ
ATNMPILNIVFAASAATASGLSRALKRRGVDAQVVVWAGDGGTADIGFQALSAAAERGED
IIYICVDNEAYMNTGIQRSGLTPYGAWTTTTHTGKRESKKPMPQIVAAHRVPYVATASVG
YPWDFIAKLRKAASIRGFKYIHLHAPCPVGWRFDPGLTVHIAKLAVETGAWILYEYENGR
LKLNPPSNKLIDPSKRKPVEEYLKLQGRFRHFKPEDVQRFKEDIERNWQEIIAILKAQGD
LK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtggctgttaacttgaggacgctacccaagaagaggtatgtgctgccaggtacagcggcg
tgccccggctgcccagaggctatggggctacgcttcctcggcatggccctgggcgagaag
gctgtcctggtcgtcccagcaggctgcacatccgtcatccagggcctcggaccaaagcag
gcaacgaatatgccgatactaaacatagtcttcgccgctagtgctgccacagccagcggg
ctctcccgcgcactgaagaggagaggcgtcgatgcccaggtggtggtgtgggctggcgac
ggcggcacggccgacataggcttccaggcgcttagcgctgcggcggagaggggcgaggac
atcatatacatctgtgtggacaacgaggcctacatgaacactggcatccagaggagcggc
ttgacaccctatggcgcctggacaaccacgacccacaccggcaagcgggagtcgaagaag
ccgatgccccagatagtagctgcgcatagggtgccatacgtagccacggcgagtgttggc
tatccatgggacttcatagcaaagctgaggaaggcggcgagcatccgtggcttcaagtac
atacacctccacgccccgtgcccggtgggctggagattcgaccccgggctaacagtccac
atagcaaagctagcagtggagacgggcgcctggatactctacgagtacgagaacggcagg
ctcaaactcaacccgccaagcaacaagctcatagacccgtcgaagaggaagccggtggag
gagtacctcaagctgcagggccgcttccgccacttcaagccagaggacgtacagaggttc
aaggaggatattgagaggaactggcaggagataatagcgatactgaaggcacagggagac
ctaaagtag

DBGET integrated database retrieval system