KEGG   Hyperthermus butylicus: Hbut_0731Help
Entry
Hbut_0731         CDS       T00468                                 

Definition
ketoisovalerate oxidoreductase subunit vorD
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
hbu  Hyperthermus butylicus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hbu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hbut_0731
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hbut_0731
   00020 Citrate cycle (TCA cycle)
    Hbut_0731
   00620 Pyruvate metabolism
    Hbut_0731
   00640 Propanoate metabolism
    Hbut_0731
   00650 Butanoate metabolism
    Hbut_0731
  Energy metabolism
   00680 Methane metabolism
    Hbut_0731
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Hbut_0731
Enzymes [BR:hbu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Hbut_0731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(719288..719503)
Genome map
AA seq 71 aa AA seqDB search
MRSVFGCYMCWLYCPEHVIEMAAGRGPRGQDIPVIDYEYCKGCGVCAQVCPVKAISMVSE
EEFLKKMQEQG
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
ttgagaagtgtgtttggctgttacatgtgttggctctactgccccgagcacgtgatagag
atggctgcggggagggggccgcgaggccaggacattcccgtgatagactacgagtactgt
aagggctgcggtgtatgcgcccaggtctgccccgtgaaggccataagcatggtttccgag
gaggagttcctcaagaagatgcaggagcaggggtga

DBGET integrated database retrieval system