KEGG   Hyperthermus butylicus: Hbut_0732Help
Entry
Hbut_0732         CDS       T00468                                 

Definition
pyruvate oxidoreductase gamma subunit
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
hbu  Hyperthermus butylicus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hbu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hbut_0732
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hbut_0732
   00020 Citrate cycle (TCA cycle)
    Hbut_0732
   00620 Pyruvate metabolism
    Hbut_0732
   00640 Propanoate metabolism
    Hbut_0732
   00650 Butanoate metabolism
    Hbut_0732
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Hbut_0732
   00680 Methane metabolism
    Hbut_0732
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Hbut_0732
Enzymes [BR:hbu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Hbut_0732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(719640..720266)
Genome map
AA seq 208 aa AA seqDB search
MQRAEGASYIPVLRETLELRFHGRGGQGAVTAATLLVQAALVEGKWGQAIPSFGAERRGA
HVLAFARIAPGPVPLHSMVRKPQVLVVLDPGLLAIERDRVLSGFQPGGKIVANLPEPVDL
GVHATLYYVNATRIAKELGLVVAGWPVVNTAMLGALARATGLVSIDSVVEAIKSYWSSSP
KIAEANAEAARRAYEETRMVQLAGREVA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
ttgcaacgcgcagagggtgcctcctacatcccggttctgagggaaaccttggagctgcgg
ttccatgggcgtggcgggcagggcgctgttaccgctgcaacactgctggttcaggcagct
cttgttgagggtaagtggggccaagcgatacccagctttggtgctgagaggcgtggagcc
cacgtactagcatttgccaggatagctccagggccggtgccgctgcacagcatggtgcgg
aagccccaggtcctagtagtgcttgatcccggcctgctcgccattgagagggaccgggtc
ctctccgggttccagcccggcggcaagatagtagcgaatctccccgagcccgtggatctg
ggtgtgcacgccacgctctactacgttaacgctacccgtatcgccaaggagctaggcctg
gtcgtggccggatggccggtggtgaatacagcgatgctcggcgccctggcgagggctacg
ggcctcgtctccatagactctgtagtcgaggcgataaagtcgtactggagctctagtcca
aagatcgccgaggcgaacgctgaggcggcgaggagggcctacgaggagacacgcatggtc
cagctcgcggggagggaggtggcctag

DBGET integrated database retrieval system