KEGG   Hyperthermus butylicus: Hbut_0768Help
Entry
Hbut_0768         CDS       T00468                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hbu  Hyperthermus butylicus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hbu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hbut_0768
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hbut_0768
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Hbut_0768
Enzymes [BR:hbu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Hbut_0768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(762230..763330)
Genome map
AA seq 366 aa AA seqDB search
MAGSAEWICPRCGWSAAIGSGYYWRCPRCSGPLQLRYTRRWEPRSGCSGLAKYSSMLPLE
VPRVLGEGGTPLVERRVEGVRVFFKLEYLNPTGSFKDRGTSLALAYASRMGFRLVVEDTS
GNTGISVAAYAAAYGLRARIYMPVNAPEGKKRLVRALGGEVVLTPSRGEAAQAVLWELKK
PDVFYVAHTWSPFYVEGAKTIAFEAFEDGFRGSAVLVPVGSGGLLLGIYHGFRELVEQGL
IDSVPRIIAVQGYSNPPLYRAVYGKEPEAEERSSRLADGLMVSEPPRLGEAAEAVKATGG
CVILVDDEGIRRGLKMLASMGFIVEPTSATLYPALLEAVERGCIDKGEEVLAPLTGSGLK
TLEYFK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
ttggctggtagcgctgaatggatttgtcctcgatgtgggtggagtgcggctataggctcc
ggctactactggcgctgcccccgttgtagcgggcctctgcagctccggtatacgcggcgc
tgggagccccgcagcggctgcagcggccttgcgaagtattcttcgatgctccccttggag
gttccccgcgttctcggggagggtggcacgccgctcgttgaacgccgcgttgagggggtt
agggtgttcttcaagctcgagtatctgaaccctaccgggagctttaaggaccgtggaacc
agccttgctttagcctatgcttcccgcatggggttcaggctggttgtagaggatacttcg
ggcaataccgggatctcagtagccgcgtacgctgccgcctacgggctccgtgcaaggata
tacatgcctgtcaatgctccggagggaaagaagaggcttgtaagagccctcggcggggag
gtggtcctgactcctagtcgtggcgaggctgcccaggccgtactatgggagctcaagaag
cctgacgtgttctatgtggctcacacctggagcccattctacgtcgagggcgcgaaaaca
atagccttcgaggccttcgaggacgggttccgtgggtcagccgtgcttgtacctgtgggt
tctggcgggctcctcctcgggatctaccatggcttccgtgagcttgtcgagcaaggcctc
atagacagcgtgcccaggatcatcgcggtgcagggctactccaacccgcccctctaccgg
gcagtctacggtaaggagcccgaagccgaggaacgcagctcgaggctagccgacggccta
atggtgtcggagccgccccggctcggtgaggctgctgaagccgtaaaggccacggggggc
tgcgtgatactcgtcgacgacgaggggattaggagggggctgaagatgttggcgtcgatg
ggcttcatagtcgagcccacgagtgcgacgctatatccggccctcctggaggctgttgag
aggggctgcatagacaagggcgaggaggtgctggcaccactcactgggtcggggctaaaa
acactcgagtacttcaagtag

DBGET integrated database retrieval system