KEGG   Hyperthermus butylicus: Hbut_0791Help
Entry
Hbut_0791         CDS       T00468                                 

Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hbu  Hyperthermus butylicus
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hbu00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(786396..787025)
Genome map
AA seq 209 aa AA seqDB search
MDRPIGLEVRRALVEAMRILHDRGLVNLLGGNASVRVTLPDGTTFIYITPSGAVKPLLSP
EDIAVIGLDGTVYEGKPSIEYRMHLAVYRSRSNVRAVVHAHNTRAVLAAALGVELDPNLL
GVEAKYYLGGCVGRVGAYEPGSEQLAEAVASALKDCNVAILEKHGAVAVGVSDDPRQAIY
EAVDRLEVLEELAEASLMAEVLRRVRIGH
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
ttggataggcctatagggcttgaggtgcgtagggcacttgttgaagctatgaggatcctg
catgaccgtgggctcgtaaacctgcttggaggtaatgcaagtgtaagggttacgttgccc
gacggcactacgttcatctatataacgcctagtggggcggttaagccgctactcagcccc
gaggatatagcagtcatagggcttgacggcacggtttacgagggaaagcctagcatcgag
taccgtatgcacctagcagtctaccgcagccgcagcaatgtaagggcagttgtccacgct
cataacacccgggcggttctcgctgcagcactcggcgtcgagttggacccaaatctccta
ggcgtcgaggccaagtactaccttgggggctgcgtgggtagggttggtgcatacgagccc
ggctctgagcagctcgcagaagctgtagcctcggcgctcaaggattgcaacgtagccatc
ctcgagaagcatggagcggtagctgtaggcgtatccgacgatcccaggcaggccatctac
gaggctgtggatagacttgaggttcttgaggagctagctgaggctagcctcatggcggag
gttttgcggcgtgtacgtattggacactag

DBGET integrated database retrieval system