KEGG   Hyperthermus butylicus: Hbut_0834Help
Entry
Hbut_0834         CDS       T00468                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hbu  Hyperthermus butylicus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hbu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Hbut_0834
Enzymes [BR:hbu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Hbut_0834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(830967..831716)
Genome map
AA seq 249 aa AA seqDB search
MAAKLAGKPTILLLRPPDSQPGPLAEIGYVAHIPIVEVVARSGAVEEVARLLGGCDWIVF
TSPRAPRFLAKLLPEIRRLQEQGRLHVAVVGPRTANVLSEAGLRVDLVPGEYRGKAVAEE
LRRRNPRCVLIPRSAAAEHNDFMLLQSMGVEVRIVHLYTAKPVERLARIAASIADEFDYV
VFTSPSIVQTLARHYNGSYKFTAAVIGPTTLAALKESKLARARTIVAEKYTMDGLAEAIR
RDWGKRAGL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
ttggcggctaagttagcgggtaagccgacgatactactgcttcgtcctcccgattcccag
ccgggcccactagccgagatagggtatgtggcacacatacccattgtagaagtcgtagcg
aggagcggggctgtggaagaggttgctaggctgctcgggggctgtgactggatagtattt
acgagtcctagggcgccaaggtttctcgcaaagctgctacctgagatacgaaggctacag
gagcaaggtagactacacgtagcagttgtcggaccccgcactgcgaatgtgctctcagag
gcagggctaagggttgacctagtgccaggcgagtaccgtggaaaagcagtggcggaggag
ctccgtcggagaaatccgcgctgcgtactaatacccagatctgcggcggcagagcataac
gacttcatgttgttgcagagcatgggtgtcgaagtccgcatagtacacctctacaccgcg
aaacccgtagagaggcttgcaagaatagctgcaagcatagcagatgagttcgactacgtg
gtcttcaccagcccgagcatagtccagacactggccaggcactacaacggctcctacaag
tttactgcagcagtaatagggccaactaccctggcagcactgaaggagtccaagctagcc
agggccaggaccatagtagcagaaaagtatacgatggatggcctagcggaggctattcgc
agggattgggggaagagagccgggttgtag

DBGET integrated database retrieval system