KEGG   Hyperthermus butylicus: Hbut_0868Help
Entry
Hbut_0868         CDS       T00468                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
hbu  Hyperthermus butylicus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hbu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
870429..871010
Genome map
AA seq 193 aa AA seqDB search
MPIDKAKIEKAVRMILEAIGEDPEREGLRETPRRVADMFEELLEGYDFTEEYTWFTEATD
LVVVSGIRFYSLCEHHLLPFFGVAHVAYLPRGKVIGLSKIVRIVNKYSRRLQIQERMTKQ
IADEISKATGSPDVMVITEAVHLCMAMRGVRNGAPTVVAAVRGEFERDQSLKEEVYRIIE
PHRLSRVIALSFF
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
ttgcccatcgataaggctaagatagagaaggctgtgagaatgatccttgaggctatcggg
gaggatccagagcgtgaagggctccgtgagacgccgcgacgagttgccgacatgtttgag
gagctgcttgagggctatgacttcaccgaagaatacacatggtttaccgaggctaccgac
ctggttgtggttagcggtataaggttctatagtctctgcgagcatcacctgctaccattc
ttcggtgtagcccatgtagcttatcttcctcgcggcaaggttatcggtttgagtaagatt
gtgcgtatagttaacaagtattctagaaggctacaaatccaggagcgtatgactaaacag
atagctgatgaaatctccaaggctacaggctcacccgacgtgatggttataactgaggct
gtacacctctgcatggctatgaggggtgtacgtaatggggcgccaactgtcgtagctgca
gtgcggggcgaatttgagcgcgaccagagcctaaaggaggaggtttacaggattatagag
ccacatagactgtcaagggttatcgcgcttagcttcttctag

DBGET integrated database retrieval system