KEGG   Hyperthermus butylicus: Hbut_0939Help
Entry
Hbut_0939         CDS       T00468                                 

Definition
(RefSeq) glyceraldehyde-3-phosphate dehydrogenase (EC:1.2.1.59)
  KO
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
hbu  Hyperthermus butylicus
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hbu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hbut_0939
   01230 Biosynthesis of amino acids
    Hbut_0939
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hbut_0939
Enzymes [BR:hbu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Hbut_0939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(945915..946946)
Genome map
AA seq 343 aa AA seqDB search
MARVRVGVNGFGTIGKRVAEAIMLQPDMELVGVTKTKPDYTAKYAVSRGIPVYVPKESLE
EFQAKGIEPAGTIEELLEKVDVIVDATPGGTGRKYKPLYEKAGVKMIFQGGEKADIAELS
FSTLCNYEQALGKTSLRVVSCNTTGLLRAICSISRLAPVRRVRATIVRRAADPKEIKRGP
VNAIKPDPVKTPSHHALDVKTVLPDLDIVTMAVVVPTTLMHVHIVYAELEKPVTREDVVA
TFESTPRILLADASYGLASTAELVEYARDLGRKRYDIPELIVWLDSIAVNGVEVMWMQAV
HQEAIVVPENIDAIRAVAELAKTAEETIRITDERLGLLKGRIP
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
gtggcacgggttagggttggcgtaaacgggtttggaactataggtaagcgtgtagctgag
gcaataatgctccagcctgacatggagcttgttggtgtcacaaaaacaaaaccagactat
accgcaaaatatgctgtgtccaggggaatacctgtctacgtgccaaaagagagcctagag
gagtttcaagctaagggcatagagccagctggcaccatagaggagctgctcgagaaagtc
gatgtcatagtcgacgctacgcccggaggtactggtagaaagtataagcctctctacgag
aaagccggggtcaagatgatatttcagggcggtgaaaaagccgacatagcagagctatcg
tttagcactctctgtaactacgaacaagcacttggcaaaacctcgctgcgtgtggtatcc
tgcaacactaccggccttctacgtgccatctgtagtatatcaagactagcccccgtaagg
cgcgtaagagcaaccattgtccggagggctgcagatcctaaggagattaaacgtggccct
gtcaacgcgataaagcctgatcctgtaaagacgcctagccatcacgctcttgacgttaag
actgtattgccagacctcgacatagtaactatggcagtagtggttccaacaacactaatg
cacgtacatatagtctacgctgaactcgagaagcctgtaacaagagaggacgtggtagca
acattcgagtccacaccaagaatactgctcgccgacgcaagctacgggctagcaagcact
gccgagctagtagagtatgctagggacctaggcagaaagcgctacgacatcccagagcta
atagtatggcttgacagtatagccgttaacggcgttgaggttatgtggatgcaagcagta
caccaagaggcaatcgtagtgccagaaaacatcgatgctataagggctgtggcagagtta
gccaagacagccgaggagaccataaggataaccgatgagagactcggcctcttgaagggc
agaataccataa

DBGET integrated database retrieval system