KEGG   Hyperthermus butylicus: Hbut_0946Help
Entry
Hbut_0946         CDS       T00468                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hbu  Hyperthermus butylicus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hbu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hbut_0946
   01230 Biosynthesis of amino acids
    Hbut_0946
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hbut_0946
   00051 Fructose and mannose metabolism
    Hbut_0946
   00562 Inositol phosphate metabolism
    Hbut_0946
Enzymes [BR:hbu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Hbut_0946
Exosome [BR:hbu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Hbut_0946
  Exosomal proteins of bladder cancer cells
   Hbut_0946
  Exosomal proteins of melanoma cells
   Hbut_0946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(953145..953924)
Genome map
AA seq 259 aa AA seqDB search
MGTVLLSGLFARYTVKREKGDAMTSRRTPILAINFKAYPTAFGEKGLAIALAADHVAAEY
GGSLEVIVAVPATEIVRVSDAVEHVKVYSQHADAVEPGPHTGFLPLEALREAGARGTIIN
HSEHRVGLNDIDFVIRRATSLGMEVLVCADTPTAAAAAAALSPTMIAIEPPELIGTGIPV
SRAKPEIVRETVRLIRMINPEAVVLTGAGITVGEDAVAAIRLGTQGVLVASAVMKASDPE
AKIRELAEALARAAEKELG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
ttgggcactgtactgctatctgggctttttgcccgctacacggtgaagagagagaagggg
gatgcaatgactagtcgccgcacgcccatactcgcgataaactttaaggcataccctacg
gcatttggtgagaaaggcttagccatagctcttgcagcagaccatgtagccgccgagtat
ggaggcagccttgaggttattgtggctgttccagcaaccgagatagtacgggtaagcgat
gctgtagagcacgtaaaggtgtatagccaacatgctgacgcggtggagcccgggcctcac
acgggatttctcccactagaggctctaagagaagctggtgcccgcggaacaatcataaac
catagcgagcaccgtgtcgggctaaacgatatagacttcgtgattagaagagcgacaagc
ttaggcatggaggtacttgtatgcgctgatactcctacagccgcagctgctgcggcggca
ttgtcgcctacgatgattgctatcgagccaccagagcttattggcaccggcatacccgtt
tctagagccaaacctgaaattgtgagagaaactgttaggctgataaggatgattaaccca
gaggcagtagtgttgacaggtgcaggcataacagttggagaggatgctgtggcagcgata
aggcttgggacgcagggtgtacttgtagcctctgcggtcatgaaggcctcggatcccgag
gcaaagatccgggagctggctgaggcgctggctagggccgccgagaaggagctaggttag

DBGET integrated database retrieval system