KEGG   Hyperthermus butylicus: Hbut_1078Help
Entry
Hbut_1078         CDS       T00468                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hbu  Hyperthermus butylicus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hbu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hbut_1078
   00030 Pentose phosphate pathway
    Hbut_1078
   00051 Fructose and mannose metabolism
    Hbut_1078
   00052 Galactose metabolism
    Hbut_1078
   00500 Starch and sucrose metabolism
    Hbut_1078
   00520 Amino sugar and nucleotide sugar metabolism
    Hbut_1078
  Nucleotide metabolism
   00230 Purine metabolism
    Hbut_1078
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Hbut_1078
Enzymes [BR:hbu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Hbut_1078
    5.4.2.8  phosphomannomutase
     Hbut_1078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1095207..1096601
Genome map
AA seq 464 aa AA seqDB search
METLGKLFGTDGVRGVLNRELTPELALRLGQAIATYFGEGATVLVARDARAGGEMILNAV
VAGLLSAGARVHVAWPDGYATTPAVQYAVKELGYDYGVIVTASHNPPEYNGVKVVGPLGI
EVDRETEARIEDIFFSERFHRTPWHRAAYEVPREHRVIETYVKGVVEKVDAPAIRRRGFR
VLVDCANSVSSLTTPKILRALGVKPYTLGCNLDPYPYREPEPTPSSLAEAAAIVRSLGLD
FGVGHDGDGDRAIIIDERGEVWWGDRTGTILAEFIAEHKLPAAPKKLYTAVSSSKLVEDY
LRPKGIEVVWVPVGTINISYRMLEEGGIAGFEENGGFIYPAHLLARDGGMTLALFLELLA
KEGKPASEVLGRLPRYYAVKLKVPMDRQKALRVVEALREEYSGKPGYRVITIDGVRIEAE
DYWFLVRPSGTEPVLRIMVEASTPEKAKEIAEALREKARRLAGG
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtggagactctgggcaagctcttcggcacggacggtgttaggggtgttctgaaccgggag
cttacgccagagctagcgttacggcttggccaggcgatagctacgtactttggtgaggga
gcaacagttctcgtcgctagggacgcccgtgccggcggcgagatgatactaaatgctgtt
gttgcaggcctgctctctgccggagccagggttcatgtcgcatggccggacggctatgct
accacgccagccgtacagtatgccgtgaaggagctgggctacgactatggcgtaatagtt
acagctagccataacccgccagagtataatggcgtcaaggtcgtaggccctctaggcata
gaggttgaccgggagacagaggcgaggatagaggatatattcttctcagagaggttccac
agaacaccgtggcaccgggcagcctacgaggtgccacgcgaacaccgcgtaattgaaacc
tacgtgaagggcgttgttgagaaggttgatgctcccgctatacgcaggagggggttccgc
gtcctcgtagactgcgccaacagcgtctcatcgcttacaacacccaagatactgcgggcg
ctaggcgttaagccatacacgctaggctgcaacctagatccctacccataccgggagccc
gagcctacgccatcaagcctagcagaagcggcagctatcgtgcggagcctaggcctagac
tttggtgtgggccacgacggggacggcgaccgagcaataatcatagatgagaggggcgag
gtctggtggggcgacaggacgggcaccatactagcagaattcattgccgagcacaagctc
ccagcagcacctaagaagctctacaccgctgtctctagcagcaagctggtagaggattac
ctccggcccaaggggattgaggttgtctgggttcccgtaggcacgataaatatcagctat
cggatgctcgaggagggtggcatagcaggcttcgaggagaacggcggcttcatataccca
gcacatctcctggcaagagatggtggcatgaccctagcactattcctggagctgctagcc
aaggagggcaagccagcctcagaggtcctcggcaggttgccgcggtactatgctgttaag
ctcaaggtgccgatggaccggcagaaggcgctaagggttgtcgaggcgctgcgcgaggag
tatagcggaaaaccaggctaccgcgtcataacaattgacggtgtgcgaatcgaagcggag
gactactggttccttgtgaggcctagtggcacagagccagtgctaaggataatggttgaa
gcatccacacccgaaaaggctaaggagatagcagaggcgcttagagagaaggctaggagg
ctggcagggggatga

DBGET integrated database retrieval system