KEGG   Hyperthermus butylicus: Hbut_1111Help
Entry
Hbut_1111         CDS       T00468                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
hbu  Hyperthermus butylicus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:hbu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Hbut_1111
Enzymes [BR:hbu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Hbut_1111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1126695..1127612
Genome map
AA seq 305 aa AA seqDB search
MVVVHAAVGNINVDIYLVVDDLPRPGENIVAREAYIGPGGAAANYSVAVRLYGHQAILVG
HTSVFAERLGILDALRGKGVSLSLVRIHEGELPGIVVVLVTPNGERTMLALRGANNMLTG
NEARCRCDVLHVASRDTNVLSNASTAASAELVSYDPGSSVARSEGAGIIEAARRHVSILY
LNKLEYEYVTGTSELDSVARLLGGKLRYVVVKLGAEGALAATPDGVYRVEAYRHGAVVDP
TGAGDVFAAYFNSALADGYSVTEALQYASVAAGVKVSRRGAQSAPSRREVEEIIASRPPR
VWRIA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggtggtagtacacgccgctgtaggcaacatcaacgttgacatataccttgtcgtagat
gatctgccgaggcctggcgagaacattgtagcacgtgaagcctacataggccctggaggc
gcggctgcaaattactctgtcgcggtcaggctctacgggcatcaagcaatacttgtagga
catactagtgtgttcgctgagcggctcggcatccttgacgcgcttagggggaagggagtc
agcctcagccttgtaaggatacatgaaggtgagttgccgggcatagtagtggtgctcgtt
acacccaacggcgaacgtaccatgcttgcgctgcgcggcgccaataacatgcttacaggt
aacgaagctaggtgtagatgtgacgtgctccacgtggctagccgtgacaccaacgtgctt
agcaatgcttctacagccgcctcggcggagctggtgtcgtacgacccaggctcctcggtt
gcacgtagtgaaggtgcaggcatcattgaggctgctaggaggcatgtgtcaatactctat
ctcaacaagctagagtacgagtacgtaacaggtacaagtgagctggatagcgttgcaagg
ctcctcggtggaaagctccgctacgttgtcgtgaaattgggtgctgagggcgcgttagct
gcaactcccgatggtgtatatcgtgtagaggcgtataggcatggagctgttgttgatccc
acaggggctggtgacgtattcgccgcatacttcaactccgcgctggccgacggctacagt
gttaccgaggctctacagtatgcttccgtagctgcgggagtgaaggtttcgagacgtgga
gcccagagtgccccttcaaggagggaggttgaagagatcattgctagccgtccgccgagg
gtctggaggatcgcctag

DBGET integrated database retrieval system