KEGG   Hyperthermus butylicus: Hbut_1154Help
Entry
Hbut_1154         CDS       T00468                                 

Definition
endoglucanase M (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
hbu  Hyperthermus butylicus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hbu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Hbut_1154
Enzymes [BR:hbu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Hbut_1154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1164473..1165597
Genome map
AA seq 374 aa AA seqDB search
MTLPISEGELDEFFKLLKKLSDAFGVSGYEDEVRGIIIDEVREAADHVEVDRFGNVIAIK
RGGRGTIKIVWDAHMDEIGFLVKHIDDKGFIYLSPVGGWTDHVLPGQRVRILTDNGTLVR
GVIGIKPPHLMKQEERSQVIPLDKLFVDIGASSREEVEKLGIRIGSPVDLDRETIRLVGD
RVTGKAFDDRVGVAVLIKAFKEFNPAEQTVYLVIATQEEVGLKGARVAAQKIQPEAAIAV
DVTTANDVPGVEAKDRVAEVGKGPALTVADGRNASGLIAHPKLLKLLMETAKAEGIPYQL
FILPGGTTDATAIALAGEGVPSAVVSVPTRYIHSPVELLSLRDAVYAAKLVAAATSRITR
EWYDREILWGKKIK
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
ttgactctacctatcagcgagggcgagctggacgagttcttcaagctactcaaaaaactc
tcagacgcctttggcgtctcgggctacgaggacgaagttagagggataattatagacgag
gtacgcgaggctgccgaccatgtggaagttgaccgcttcggcaatgttatcgccataaaa
cgtggaggccgcggcaccatcaaaatcgtctgggacgctcacatggacgagatagggttc
ctagtcaaacacatagatgataaaggctttatctatctctcaccagtcggcggctggacc
gaccacgtgctgcccgggcagagggtgcgaatactcacagacaacggtactttagtacga
ggcgtgatagggataaagccaccacacctcatgaagcaggaagagcgcagccaggtgata
cccctcgacaaactcttcgtagacatcggtgcttcgagcagggaggaggttgagaagctc
ggtataaggattggaagccctgtagaccttgaccgagagacgatacggctggttggcgac
agggtaaccggcaaggcctttgacgaccgtgtcggcgtagctgtgctcataaaggcgttc
aaggagtttaaccctgctgagcagaccgtataccttgtcatagctacgcaggaggaggta
ggccttaagggcgcacgtgtggcagctcagaagatacagccagaggcagcaatagccgta
gacgtcacaaccgccaatgacgtaccaggtgtagaggcaaaggaccgcgtggcagaggta
ggtaaggggcccgcattgaccgttgccgatgggaggaatgctagcgggctcatagcgcat
cccaaactgctaaagctgcttatggaaacagctaaggctgaggggataccctaccaactc
ttcatcctacctggaggtaccaccgacgccaccgccatagcgctagcaggggagggtgta
ccctcagccgtggtatcggtgccaacacgttacatccacagccctgtcgagctgctaagc
ctccgcgacgcagtatacgccgcgaagcttgtcgcagcggctacctcgaggataaccagg
gagtggtacgaccgcgaaatactgtggggcaagaagataaagtag

DBGET integrated database retrieval system