KEGG   Hyperthermus butylicus: Hbut_1154Help
Entry
Hbut_1154         CDS       T00468                                 

Definition
(GenBank) Endoglucanase M (EC:3.2.1.4)
Organism
hbu  Hyperthermus butylicus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1164473..1165597
Genome map
AA seq 374 aa AA seqDB search
MTLPISEGELDEFFKLLKKLSDAFGVSGYEDEVRGIIIDEVREAADHVEVDRFGNVIAIK
RGGRGTIKIVWDAHMDEIGFLVKHIDDKGFIYLSPVGGWTDHVLPGQRVRILTDNGTLVR
GVIGIKPPHLMKQEERSQVIPLDKLFVDIGASSREEVEKLGIRIGSPVDLDRETIRLVGD
RVTGKAFDDRVGVAVLIKAFKEFNPAEQTVYLVIATQEEVGLKGARVAAQKIQPEAAIAV
DVTTANDVPGVEAKDRVAEVGKGPALTVADGRNASGLIAHPKLLKLLMETAKAEGIPYQL
FILPGGTTDATAIALAGEGVPSAVVSVPTRYIHSPVELLSLRDAVYAAKLVAAATSRITR
EWYDREILWGKKIK
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
ttgactctacctatcagcgagggcgagctggacgagttcttcaagctactcaaaaaactc
tcagacgcctttggcgtctcgggctacgaggacgaagttagagggataattatagacgag
gtacgcgaggctgccgaccatgtggaagttgaccgcttcggcaatgttatcgccataaaa
cgtggaggccgcggcaccatcaaaatcgtctgggacgctcacatggacgagatagggttc
ctagtcaaacacatagatgataaaggctttatctatctctcaccagtcggcggctggacc
gaccacgtgctgcccgggcagagggtgcgaatactcacagacaacggtactttagtacga
ggcgtgatagggataaagccaccacacctcatgaagcaggaagagcgcagccaggtgata
cccctcgacaaactcttcgtagacatcggtgcttcgagcagggaggaggttgagaagctc
ggtataaggattggaagccctgtagaccttgaccgagagacgatacggctggttggcgac
agggtaaccggcaaggcctttgacgaccgtgtcggcgtagctgtgctcataaaggcgttc
aaggagtttaaccctgctgagcagaccgtataccttgtcatagctacgcaggaggaggta
ggccttaagggcgcacgtgtggcagctcagaagatacagccagaggcagcaatagccgta
gacgtcacaaccgccaatgacgtaccaggtgtagaggcaaaggaccgcgtggcagaggta
ggtaaggggcccgcattgaccgttgccgatgggaggaatgctagcgggctcatagcgcat
cccaaactgctaaagctgcttatggaaacagctaaggctgaggggataccctaccaactc
ttcatcctacctggaggtaccaccgacgccaccgccatagcgctagcaggggagggtgta
ccctcagccgtggtatcggtgccaacacgttacatccacagccctgtcgagctgctaagc
ctccgcgacgcagtatacgccgcgaagcttgtcgcagcggctacctcgaggataaccagg
gagtggtacgaccgcgaaatactgtggggcaagaagataaagtag

DBGET integrated database retrieval system