KEGG   Hyperthermus butylicus: Hbut_1469Help
Entry
Hbut_1469         CDS       T00468                                 

Definition
(GenBank) predicted Acetylornithine deacetylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hbu  Hyperthermus butylicus
Pathway
hbu00300  Lysine biosynthesis
hbu01100  Metabolic pathways
hbu01120  Microbial metabolism in diverse environments
hbu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hbu00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Hbut_1469
Enzymes [BR:hbu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Hbut_1469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Phosphonate-bd
Motif
Other DBs
NCBI-ProteinID: ABM81293
UniProt: A2BMT2
Position
1477356..1478603
Genome map
AA seq 415 aa AA seqDB search
MSSSGGSEELYVVRLLEKLISVPTVNPPGENYQEMATLLREELEALGLEVSIVRVPDDVV
EKYYPWAQGYPRFIVVARLYSGAEEQPVLHFNGHYDVVPPGQGWSLDPFKPVVRDGKVYG
RGASDMKGGIAAIIAAVRSLVEQGWRPRKGVLELSFTPDEETGGETGVGYMLEEGIALPD
YAVVAEPSTTERIWIGSRGNLWLNVHIYGKQAHGSTPWSGLNAFEGMVEIAYRLIHEYKP
LLEERKTDLPMDDPRAAKPTVTLGGEVQGGAKTNIVPGYYRFSIDRRIIPGENPDEVEKE
LREFIDRVSAPLRARGYRVEVEVTAKAPATWIPPDHNFVELVASTIRDMLGIEPLRTICV
GGLDTRYFQLRGIPAVTYGPGALDAAHKPDEYVPIEELVRAKKVYMELAKRVLGA
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctagtggtggtagcgaggagctctatgttgttaggttattggagaagttgatc
tccgtgccaactgtcaatcctcctggcgagaactaccaggagatggctacgctgctgaga
gaggagcttgaggctctaggcctggaggttagtattgtgagggttcccgacgatgttgtc
gagaagtattatccctgggctcagggctatcctcgcttcatagtcgttgcccgtctctac
tcgggtgctgaagagcagcctgtgctgcacttcaacgggcactacgatgttgtgccgccg
gggcaggggtggagcctcgacccgttcaagccggtggtacgcgacgggaaggtctacggc
cgtggcgcgagcgacatgaagggcggcatagctgccatcattgctgctgtccggagcctt
gtggagcagggctggaggcctcggaagggtgtgctagagctgagctttacgcccgacgag
gagacgggtggcgagaccggcgtaggctacatgctcgaggagggcatagcgcttccagac
tatgctgtggtggctgagcccagcaccactgagcggatatggattggtagcaggggtaac
ctctggctaaacgttcacatctacggtaagcaagcgcacggctcaacaccttggagtggg
cttaacgcgttcgagggaatggtcgagatagcctatcgactcatacacgagtataaaccg
cttctcgaggagaggaagacagacctgccaatggatgatcccagagccgccaagccaact
gtaacgcttggcggcgaggtgcaaggcggggcgaagacgaacatcgtgccaggctactac
cggtttagcattgatcgccgcataatacccggcgaaaaccccgacgaggtggagaaagag
ctgcgagaattcatagaccgtgtctctgcgcctttgcgcgcccggggctaccgtgtcgag
gtagaggttaccgctaaggcgcccgcgacatggataccgcctgaccacaactttgtggag
ctcgtagcctcaaccatacgcgacatgctaggcatagaacccctccgcaccatctgcgta
gggggcctcgatactaggtacttccagctccgcggcataccagctgtaacctatggccca
ggtgcactcgacgctgcccataagcccgacgagtacgtacccatagaggagcttgttagg
gctaagaaggtctacatggagcttgcaaagagagtacttggagcctag

DBGET integrated database retrieval system