KEGG   Helicobacter pylori PeCan18: HPPC18_01160Help
Entry
HPPC18_01160      CDS       T02036                                 

Definition
disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hca  Helicobacter pylori PeCan18
Brite
Enzymes [BR:hca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     HPPC18_01160
Secretion system [BR:hca02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   HPPC18_01160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
237465..238262
Genome map
AA seq 265 aa AA seqDB search
MILRASVLSALLLAGLGAAPKHSVSANDKRMQDNLVSVIEKQTNKKVRILEVKPLKSSQD
LKMVVIEDPDTKYNIPLVVSKDGNLVIGLGGIFFSNNSEDVKLLTETNQKIQALNATQQN
SAKLNAIFDEIPADYAIELPSTNAANKDKILYIVSDPMCPHCQKELTKLRDHLKENTVRM
VVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTK
VENTTKKIFESGVIKGVPFLYHYKA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgatattaagagcgagtgtgttgagcgcgttacttcttgcaggcttaggggcagcccct
aaacattcagtttcagctaatgacaaacggatgcaggataatttagtgagcgtgattgaa
aaacaaaccaataaaaaggtgcgtattttagaagtcaaacctttaaaatccagccaggat
ttaaaaatggtcgtcattgaagatccggacactaaatacaatatcccgcttgtagtgagt
aaggatggtaatttagtcatagggcttggcggtatcttttttagcaataatagcgaagac
gtgaagttgctcacagaaaccaatcaaaaaatccaagcccttaacgccacccaacaaaat
agtgcgaaattgaacgctatttttgatgaaataccggctgattatgcgatagagttgccc
tctactaacgctgcaaataaggataaaatcctttatattgtctctgatcccatgtgcccg
cactgccaaaaagagctcactaagctcagggatcacttgaaagaaaacaccgtgagaatg
gttgtagtggggtggcttggggtcaattcggctaaaaaagcggctttgatccaagaagaa
atggcgaaggctagggctaggggagcgagcgtggaagataaaatctctattcttgaaaag
atttattccacccaatacgatattaacgcccaaaaagagcctgaagatttacgcactaaa
gtggaaaacaccactaaaaagatttttgaatctggcgtgattaagggcgtgcctttcttg
tatcattataaggcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system