KEGG   Helicobacter pylori PeCan18: HPPC18_02045Help
Entry
HPPC18_02045      CDS       T02036                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hca  Helicobacter pylori PeCan18
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HPPC18_02045
Enzymes [BR:hca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     HPPC18_02045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
416526..417017
Genome map
AA seq 163 aa AA seqDB search
MMREILTNRFFPSLFKKRLDFSNRVVLGLGSNLKNPLKILKNCFLYFKNHSQIGKIFSSP
IYINPPFGYTKQPNFYNATIILKTSLSLRHFFALVFYIERRFGRKRKRDFKDAPRTLDID
IIAFNQVILRQNDLTLPHPKWSERDSVLVPLTLQQILFKKGEW
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcgagagatccttactaaccgctttttcccaagcctttttaaaaaaaggcttgat
ttttctaacagagtggttttagggttgggatctaatcttaaaaatcctttaaaaatatta
aaaaattgttttttatactttaaaaatcatagtcagatcggaaaaattttttcttcgccg
atttatatcaatccgccttttggttacactaagcaacctaatttctacaacgctacgatt
atccttaaaacatctttaagtttgcgccatttttttgctctagttttttatatagaaagg
cgttttgggcgcaaaaggaagcgcgattttaaagacgctccaagaactttggatattgat
attatcgctttcaatcaagtcattttgaggcagaatgatttgactttacctcaccctaaa
tggagtgaaagggattcggtattagtgcctttaactttacaacaaatcctttttaaaaaa
ggggagtggtga

DBGET integrated database retrieval system