KEGG   Helicobacter pylori PeCan18: HPPC18_02380Help
Entry
HPPC18_02380      CDS       T02036                                 

Definition
(GenBank) phospholipase A1
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
hca  Helicobacter pylori PeCan18
Pathway
hca00564  Glycerophospholipid metabolism
hca00565  Ether lipid metabolism
hca00592  alpha-Linolenic acid metabolism
hca01100  Metabolic pathways
hca01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hca00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    HPPC18_02380
   00565 Ether lipid metabolism
    HPPC18_02380
   00590 Arachidonic acid metabolism
    HPPC18_02380
   00591 Linoleic acid metabolism
    HPPC18_02380
   00592 alpha-Linolenic acid metabolism
    HPPC18_02380
Enzymes [BR:hca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     HPPC18_02380
    3.1.1.32  phospholipase A1
     HPPC18_02380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: AFI02253
UniProt: I0EH34
Position
488229..489296
Genome map
AA seq 355 aa AA seqDB search
MRSILLFMIFVVCQLEGKKFSQDNFKVDYNYYLRKQDLHIIKTQNDLSNAWYLPPQKAPK
EHSWVDFAKKYLNMMDYLGTYFLPFYHSFTPIFQWYHPNINPYQRNEFKFQISFRVPVFR
HILWTKGTLYLAYTQTNWFQIYNNPQSAPMRMINFMPELIYVYPINFEPFGGKIGKFSEI
WIGWQHISNGVGGVQCYQPFNKEGNPENQFPGQPVIVKDYNGQKDVRWGGCRSVSAGQRP
VFRLVWEKGGLKIMVAYWPYVPYDQSNPNLIDYMGYGNAKVDYRRGRHHFELQLYDIFTQ
YWRYDRWHGAFRLGYTYRINPFVGIYAQWFNGYGDGLYEYDVFSNRIGVGIRLNP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagaagcattttgctctttatgatttttgtagtttgtcagttagaaggcaaaaaattt
tcacaagataattttaaggtggattataactactatttgcgcaaacaggatttgcacatc
attaaaacgcaaaacgatttatctaatgcctggtatctccctccacaaaaagcccccaaa
gaacattcttgggtggattttgctaaaaaatatttaaacatgatggattatctaggcact
tattttctgcctttttatcatagtttcacccccatttttcaatggtaccaccccaatatc
aacccctatcaacgcaatgagtttaagttccagattagttttagagtgcctgtatttagg
catattctttggactaaaggcacgctttatctggcttacacccaaactaactggtttcaa
atttacaataaccctcaatccgctcccatgcgaatgatcaatttcatgcctgaactcatt
tatgtttatcctatcaattttgaaccttttgggggtaaaatagggaaattttctgagatt
tggataggttggcagcacatttctaatggcgtggggggcgtgcaatgttaccagcctttt
aataaagaaggcaatcctgaaaaccagtttccaggacaacctgtaatcgttaaagattat
aacgggcaaaaagatgtgcgttggggggggtgtcgttcggtgagcgcggggcaacgccct
gtgtttcgtttggtgtgggaaaagggaggcttgaaaatcatggtcgcttattggccctat
gtcccttatgatcaatccaaccctaatttgattgattacatggggtatggtaacgctaaa
gttgattacaggagagggcgccaccattttgaattgcaactttatgatattttcacgcaa
tactggcgttatgatcgctggcatggagctttccgcttaggctatacctaccgcattaac
ccttttgtggggatttatgcacagtggtttaacggctatggcgatggcttgtatgaatac
gatgttttttccaatcgtataggggtaggaatacgcttaaacccttaa

DBGET integrated database retrieval system