KEGG   Helicobacter pylori PeCan18: HPPC18_03125Help
Entry
HPPC18_03125      CDS       T02036                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase subunit GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hca  Helicobacter pylori PeCan18
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hca00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HPPC18_03125
   00052 Galactose metabolism
    HPPC18_03125
   00500 Starch and sucrose metabolism
    HPPC18_03125
   00520 Amino sugar and nucleotide sugar metabolism
    HPPC18_03125
Enzymes [BR:hca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HPPC18_03125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
654194..655015
Genome map
AA seq 273 aa AA seqDB search
MIKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLIQYAVEEAMEAGCEVMAIVTGRNKR
SLEDYFDTSYEIEHQIQGTNKENALKSIRNIIEKCCFSYVRQKQMKGLGHAILTGEALIG
NEPFAVILADDLCISHDHPSVLKQMTSLYQKYQCSIVAIEEVALEEVSKYGVIRGELLEE
GVYEIKDMVEKPSQEDAPSNLAVIGRYILTPDIFEILSETKPGKNNEIQITDALRTQAKR
KRIIAYQFKGKRYDCGSVEGYIEASNAYYKKRL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgcctttttcctgccgctggctatggcacgcgctttttgccgatcact
aaaaccattcctaaagaaatgctgcccattgtggataagcctttaatccaatacgctgtg
gaagaagcgatggaagcgggctgtgaagtgatggcgattgttacgggcaggaataaacga
agcttagaagattattttgacacgagctatgaaatagagcatcaaatccaaggcactaac
aaagaaaacgccttaaaaagcattcgtaacattatagaaaaatgctgtttttcctatgtg
cgccaaaagcaaatgaaaggcttagggcatgcgattttaaccggggaagccctcataggc
aatgagccttttgcggtgattttagccgatgacttatgcataagccatgatcacccaagc
gtgttaaagcaaatgacttcgttgtatcaaaaataccaatgctccattgtcgccattgaa
gaagtagcgttagaagaagtttcaaaatacggcgtgatcaggggcgaattgttagaagag
ggggtgtatgagattaaagacatggtggaaaaaccaagccaagaagacgccccaagcaat
ctagccgtgatagggcgctacattttaaccccagatatttttgaaattttaagcgagacg
aaaccgggtaaaaacaatgaaatccaaatcacagacgccttacgcactcaagccaaaaga
aaacggatcatcgcttaccaattcaaaggcaaacgatacgattgcgggagcgtggaaggc
tatattgaagcgagtaacgcttattataaaaaacgcctataa

DBGET integrated database retrieval system