KEGG   Helicobacter pylori PeCan18: HPPC18_04545Help
Entry
HPPC18_04545      CDS       T02036                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
hca  Helicobacter pylori PeCan18
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hca00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HPPC18_04545 (recR)
DNA repair and recombination proteins [BR:hca03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      HPPC18_04545 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
954983..955564
Genome map
AA seq 193 aa AA seqDB search
MNTYKNSLNHFLNLVDCLEKIPNVGKKSAFKMAYHLGLENPYLALKITHALENALENLKT
CASCNALSESEVCEICSDESRQNSQLCMVLHPRDVFILEDLKDFLGRYYVLNSIEEVDFN
ALEKRLVGENIKEIIFAFSPTLANDSLMLYIEDKLQHLHLTFTKIAQGVPTGVNFENIDS
VSLSRAFNSRIKA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaatacttataaaaacagcttgaatcactttttaaatttagtggattgtttagaaaaa
atccccaatgtgggtaaaaaatccgcctttaaaatggcgtatcatttgggtttagaaaac
ccctatctggcactcaaaattacgcacgctttagagaacgccctagaaaaccttaaaaca
tgcgcatcttgtaacgcactcagtgagagtgaggtttgtgagatttgctctgatgagagc
cggcaaaattctcagctttgcatggttttacacccaagagatgtgtttattttagaagat
ttaaaggactttttagggcgctattatgtgttaaattctatagaagaagtggattttaac
gccttagaaaaacgcctggttggagaaaacattaaagaaatcatttttgctttctctccc
actttagccaatgattctttaatgctctatattgaagataaattgcaacatctccatctc
actttcactaaaatcgctcaaggcgtgcctactggagtgaattttgaaaacattgactca
gtttcgctctcaagggcgtttaattcaaggatcaaggcatga

DBGET integrated database retrieval system