KEGG   Helicobacter pylori PeCan18: HPPC18_05495Help
Entry
HPPC18_05495      CDS       T02036                                 

Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit gamma
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
hca  Helicobacter pylori PeCan18
Pathway
hca00010  Glycolysis / Gluconeogenesis
hca00020  Citrate cycle (TCA cycle)
hca00620  Pyruvate metabolism
hca00640  Propanoate metabolism
hca00650  Butanoate metabolism
hca00680  Methane metabolism
hca01100  Metabolic pathways
hca01120  Microbial metabolism in diverse environments
hca01130  Biosynthesis of antibiotics
hca01200  Carbon metabolism
Module
hca_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPPC18_05495
   00020 Citrate cycle (TCA cycle)
    HPPC18_05495
   00620 Pyruvate metabolism
    HPPC18_05495
   00640 Propanoate metabolism
    HPPC18_05495
   00650 Butanoate metabolism
    HPPC18_05495
  Energy metabolism
   00680 Methane metabolism
    HPPC18_05495
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPPC18_05495
Enzymes [BR:hca01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPPC18_05495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR MAF_flag10
Motif
Other DBs
NCBI-ProteinID: AFI02829
UniProt: I0EIR0
Position
1158444..1159004
Genome map
AA seq 186 aa AA seqDB search
MFQIRWHARAGQGAITGAKGLADVISKTGKEVQAFASYGSAKRGAAMMAYNRVDDEPILN
HERFMQPDYVLVIDPGLVFIENIFANEKEDTTYIITSYLNKEELFEKKPELKTRKVFLVD
CLKISMETLKRPIPNTPMLGALMKVSGMLEIEAFKEAFKKVLGKKLTQEVIDANMLAIQR
AYEEVQ
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaattagatggcatgcgcgagctggtcaaggcgctatcaccggtgctaaaggg
ttggctgatgtgatttcaaaaacaggcaaagaagtgcaagcgttcgcttcctatggttca
gctaaaaggggggctgctatgatggcttataaccgcgttgatgatgagcctattttaaac
catgagcgcttcatgcagcctgattatgtgctggtgattgaccctggtttggttttcatt
gaaaacatcttcgctaatgaaaaagaagacacgacctatatcatcaccagctaccttaac
aaagaagaattgtttgaaaaaaaacctgaattaaaaacccgtaaagtgtttttagtggat
tgtttaaaaatctctatggaaaccttaaaacgccccatccccaacacgcccatgctagga
gcgttaatgaaagtgtctggcatgcttgaaattgaggcttttaaagaagcttttaagaaa
gttttaggcaaaaaactcacgcaagaagtcattgacgctaacatgctcgctatccaaaga
gcttatgaagaagttcaataa

DBGET integrated database retrieval system