KEGG   Helicobacter pylori PeCan18: HPPC18_05500Help
Entry
HPPC18_05500      CDS       T02036                                 

Gene name
porD
Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit delta
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
hca  Helicobacter pylori PeCan18
Pathway
hca00010  Glycolysis / Gluconeogenesis
hca00020  Citrate cycle (TCA cycle)
hca00620  Pyruvate metabolism
hca00640  Propanoate metabolism
hca00650  Butanoate metabolism
hca00680  Methane metabolism
hca01100  Metabolic pathways
hca01120  Microbial metabolism in diverse environments
hca01130  Biosynthesis of antibiotics
hca01200  Carbon metabolism
Module
hca_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPPC18_05500 (porD)
   00020 Citrate cycle (TCA cycle)
    HPPC18_05500 (porD)
   00620 Pyruvate metabolism
    HPPC18_05500 (porD)
   00640 Propanoate metabolism
    HPPC18_05500 (porD)
   00650 Butanoate metabolism
    HPPC18_05500 (porD)
  Energy metabolism
   00680 Methane metabolism
    HPPC18_05500 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPPC18_05500 (porD)
Enzymes [BR:hca01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPPC18_05500 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_10 Fer4_2 Fer4_7 Fer4_9 Fer4_17 Fer4_16 Fer4_15 Fer4_13 Fer4_8 Fer4_4 Fer4_22 Fer4_3
Motif
Other DBs
NCBI-ProteinID: AFI02830
UniProt: I0EIR1
Position
1159020..1159412
Genome map
AA seq 130 aa AA seqDB search
MKDWNEFEMGAVLFPFEKNAQSEMEKHNDERHYTEQSYFTTSVAHWRVAKPVHNNNICIN
CFNCWVYCPDAAILSREGKLKGVDYSHCKGCGVCVDVCPTNPKSLWMFEEQIEPATALTQ
WPQKQEKKKS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattggaatgaatttgaaatgggagcggtgctcttcccttttgaaaagaacgca
caaagcgaaatggaaaaacacaatgatgagcgccattacaccgaacagagttacttcacc
acttcagtggctcattggcgcgtggctaaacctgtgcataacaataatatttgcatcaat
tgctttaattgttgggtttattgcccagacgctgccattctttcaagagagggcaaatta
aaaggcgtggattattctcattgtaaaggctgtggcgtgtgcgtggatgtctgccccact
aaccctaaatccctatggatgtttgaagaacaaattgagcctgccaccgctctcactcaa
tggccgcaaaaacaagaaaagaaaaaatcataa

DBGET integrated database retrieval system