KEGG   Helicobacter pylori PeCan18: HPPC18_05505Help
Entry
HPPC18_05505      CDS       T02036                                 

Gene name
porA
Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit alpha
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
hca  Helicobacter pylori PeCan18
Pathway
hca00010  Glycolysis / Gluconeogenesis
hca00020  Citrate cycle (TCA cycle)
hca00620  Pyruvate metabolism
hca00640  Propanoate metabolism
hca00650  Butanoate metabolism
hca00680  Methane metabolism
hca01100  Metabolic pathways
hca01120  Microbial metabolism in diverse environments
hca01130  Biosynthesis of antibiotics
hca01200  Carbon metabolism
Module
hca_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPPC18_05505 (porA)
   00020 Citrate cycle (TCA cycle)
    HPPC18_05505 (porA)
   00620 Pyruvate metabolism
    HPPC18_05505 (porA)
   00640 Propanoate metabolism
    HPPC18_05505 (porA)
   00650 Butanoate metabolism
    HPPC18_05505 (porA)
  Energy metabolism
   00680 Methane metabolism
    HPPC18_05505 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPPC18_05505 (porA)
Enzymes [BR:hca01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPPC18_05505 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: AFI02831
UniProt: I0EIR2
Position
1159422..1160645
Genome map
AA seq 407 aa AA seqDB search
MAKSIELQEIEVWDGNTASSNALRQAQIDVIAAYPITPSTPIVQNYGSFKDNGYVDGEFV
LVESEHAAMSACVGAAAAGGRVSTATSSQGLALMVEVLYQASGMRLPIVLNLVNRALAAP
LNIHGDHSDMYLSRDSGWISLCTCNPQEAYDFTLMAFKIAEHQKVRVPTIVNQDGFLCSH
TVQNVRPLSDTVAYQFVGEYQTKHSLLDFDKPVSYGAQAEEEWHYEHKAQLHHAIMSASS
VIEEVFNDFAKLTGRQYHLTKTFQLEDAEIAIFALGTTYESAIVAAKEMRKKGIKAGVAT
IHSLRPFPYERLGQDLKNLKALAILDKSSPAGAMGAMFNEVTSAVYQTQGTKHPVVSNYI
YGLGERDMTIAHLCEIFEEINEDALKGTLTHPTQQFVGLHGPKMSFF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaagtattgaattgcaagagatagaagtgtgggatggcaataccgctagctct
aacgctttaagacaggctcaaattgatgtcatcgcagcctatcctatcaccccttcaacg
cccattgtgcaaaattatggctcgtttaaggataacggatatgttgatggcgagtttgtt
ttagtggaatctgagcatgccgccatgagtgcatgcgtgggagcggcggcagcaggtgga
agggtcagcactgcaactagctctcaaggtttggcgttaatggtagaggttttataccag
gcttctggcatgcgtttgcctattgttttgaatttggtcaatcgtgctctagcagcccct
ttaaatatccatggcgatcattctgatatgtatttaagcagggattctggctggatcagt
ttatgcacatgcaaccctcaagaagcttatgatttcactttaatggcgtttaaaatcgca
gagcatcaaaaggtgcgcgtgcctactattgtcaatcaagatggttttttatgttcgcac
accgtgcagaatgtccgccctttgagcgatacagtagcttatcaattcgtaggcgaatac
caaaccaagcattcccttttggattttgacaaaccggtaagctatggtgcacaagctgaa
gaagaatggcattatgagcataaagcccaactccaccatgcgatcatgagcgcgtcttct
gtgattgaagaagtgttcaatgatttcgctaaactcacaggcagacaataccatttgact
aaaactttccagctagaagacgctgaaatcgctatctttgcgttaggcactacttatgaa
tccgcgatcgtagcggctaaggaaatgcgtaaaaaaggcattaaggccggcgtggctacc
atccattccttgcgccctttcccttatgaaagattggggcaggatttgaaaaatcttaag
gctctagcgattttagacaagagctctccagcgggtgctatgggggcgatgtttaatgaa
gtaacgagcgcggtgtatcaaacccaagggactaaacaccccgtggtgtctaactacatt
tatggtttaggcgaaagggatatgacaatcgcgcatttatgcgagatttttgaagaaatc
aatgaagacgctcttaaaggcacgctcacgcaccctacccaacaattcgtaggcttgcac
ggccctaaaatgagctttttttaa

DBGET integrated database retrieval system