KEGG   Helicobacter pylori PeCan18: HPPC18_06130Help
Entry
HPPC18_06130      CDS       T02036                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hca  Helicobacter pylori PeCan18
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HPPC18_06130
Enzymes [BR:hca01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     HPPC18_06130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1297345..1298487
Genome map
AA seq 380 aa AA seqDB search
MIVKRLNPDALKSALQKIGPEKIAQTHMHQKGVSFVFEIQHLPLSAALILKQEAISVGGD
FATPRDCILAKEPFYDGVLIASAKQLERLIVKCHSQPFGLKHLAQELKSHLKAPKPNTPQ
IMAVLNLTPDSFYEKSRFDSKKALEEIYQWLEKGITLIDIGAASSRPQSEIIDPKVEQDR
LKEVLLEIKSQKLYQYAHFSIDTYHAKTAQMALEHCFSILNDVSGFNSIEMLEVARDYKP
TCILMHAQKTPKDMQENVFYHNLFDEMDRFFKEKLEVLEKYALQDIILDIGFGFAKLKEH
NLALIKHLSHFLKFKKPLLVGASRKNTIGLITGREVQNRLAGTLSLHLMALQNGASILRA
HDIDEHIDLIKVFKSLEEAD
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgattgtaaaacgccttaaccctgatgcgctcaaaagcgctctgcaaaaaataggccca
gaaaagatcgcgcaaacccacatgcaccaaaaaggcgttagttttgtttttgagatccaa
cacctgcccttaagcgctgcgctcattttaaaacaagaagccataagcgttgggggcgat
tttgccacgccaagagattgcattttggctaaagagcctttttatgatggggtgttgatt
gcgagcgctaagcaattagaacgccttattgtgaagtgccattcccaaccctttgggctt
aaacatttagcgcaagaattaaaaagccaccttaaagcccccaagcctaacaccccacaa
atcatggcggttttaaacttgactccggatagtttctatgaaaagagccgttttgatagc
aaaaaagcgcttgaagaaatctatcaatggctagaaaagggtatcacgctcattgatata
ggcgcggccagttcaaggccacagagtgaaatcattgatccaaaagtagagcaagatcgc
ttgaaagaagttttattagaaatcaaatcccaaaaactctaccaatacgcgcattttagc
atagacacctaccatgctaaaacggcccaaatggctttggagcattgtttttctatcctt
aatgatgtgagcggttttaatagcattgaaatgctagaagtcgcacgagattacaaaccc
acttgcattttaatgcacgctcaaaaaacccccaaagacatgcaagaaaatgttttttac
cacaatttatttgatgaaatggatcgcttctttaaggaaaaattagaggttttagaaaaa
tacgcgcttcaagatattattttagatattgggtttggattcgctaaattaaaagagcat
aatttagccttaatcaagcatttaagccattttcttaaattcaaaaaacccttgttggtg
ggagcgagtcgtaaaaacacgatcgggcttatcaccgggcgtgaagttcaaaaccggctc
gctggcactttgagtttgcatttaatggcgttgcaaaatggagcgagtattttaagagcg
catgatattgatgagcatatagatttaatcaaggtgtttaagagtttggaagaagcggat
tga

DBGET integrated database retrieval system