KEGG   Helicobacter pylori PeCan18: HPPC18_06365Help
Entry
HPPC18_06365      CDS       T02036                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hca  Helicobacter pylori PeCan18
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPPC18_06365
   00030 Pentose phosphate pathway
    HPPC18_06365
   00051 Fructose and mannose metabolism
    HPPC18_06365
   00052 Galactose metabolism
    HPPC18_06365
   00500 Starch and sucrose metabolism
    HPPC18_06365
   00520 Amino sugar and nucleotide sugar metabolism
    HPPC18_06365
  Nucleotide metabolism
   00230 Purine metabolism
    HPPC18_06365
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPPC18_06365
Enzymes [BR:hca01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HPPC18_06365
    5.4.2.8  phosphomannomutase
     HPPC18_06365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1342599..1343975
Genome map
AA seq 458 aa AA seqDB search
MDISIFREYDIRGIYPTTLDENTAFSIGVELGKIMREYDKSVFVGHDARVHGHFLFEALS
AGLQSSGLKVYDLGLIPTPVAYFAAFNEINGIQCPNSIMITGSHNPKEYNGFKITLNQNP
FYGKDIQALKNTLLNAKHEIKPLKETPEKVNALEAYQRYLIKDFQHLKNLKYKIALDFGN
GVGALGLEPILKALNIDFSSLYSDPDGNFPNHHPDPSEAKNLKDLEKHMRENAILIGFAF
DGDADRIAMLSSHHIYAGDELAILFAKRLHAQGITPFVIGEVKCSQVMYNTINTFGKTLM
YKTGHSNLKIKLKETHAHFAAEMSGHIFFKERYFGYDDALYVCLRALELLLEQSPSDLEN
TIKNLPYSYTTPEEKIAVSEEEKFEIIHNLQKALKNPPSHFPKIKEIISIDGVRVVFEHG
FGLIRASNTTPYLVSRFEGKDETTALEYKRALLNLLEK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggacattagcatttttagagaatacgatattagaggcatttaccccaccactttagat
gaaaatacggcttttagtatcggcgtggagttggggaaaatcatgcgagaatacgataaa
agcgtgtttgtagggcatgacgcaagggtgcatgggcactttttgtttgaagctttgagc
gcggggctgcaatcaagcggcttgaaagtgtatgatttagggctaatccccacaccggta
gcgtattttgcggcctttaatgaaatcaatggcattcaatgccctaattccatcatgatc
actggctctcacaaccccaaagaatacaacggctttaaaatcacgctcaaccaaaacccg
ttttatggcaaggacattcaggctttaaaaaacacgcttttaaacgcaaagcatgaaata
aaacccttaaaagaaacgccagagaaagtcaatgccctagaagcgtatcaacgctatttg
atcaaggattttcagcatttaaagaatcttaaatacaaaatcgccctggattttggtaat
ggcgtgggggcgttaggattagagccgattttaaaggctttaaacattgattttagcagc
ctttatagcgaccctgatgggaatttccctaaccaccacccagaccctagcgaagcgaaa
aacttaaaagatttagaaaaacacatgcgagaaaacgctattttgataggctttgctttt
gatggcgatgcggataggattgcgatgctaagctctcatcatatttatgcgggcgatgaa
ttagcgattttattcgctaaacgcttgcatgctcaaggcatcaccccctttgtgataggc
gaagtcaaatgctctcaagtgatgtataacacgattaatacttttggtaagacgctcatg
tataaaaccgggcatagcaatttaaaaatcaaactcaaagaaacccatgcgcattttgcg
gctgaaatgagcgggcatatcttttttaaagagcgctattttggctatgatgacgctctt
tatgtatgcttaagggctttagaattattgcttgaacaaagtccaagcgatttggaaaac
accattaaaaacctcccttattcctacaccacgcctgaagaaaaaatcgccgtgagcgaa
gaagaaaaatttgaaatcattcataacctgcaaaaagcgcttaaaaacccgccaagtcat
ttccctaaaatcaaagaaatcatcagcattgatggcgtgagggtggtttttgaacatggt
tttgggcttattcgcgcaagcaacaccaccccctatttagtcagccgctttgaaggcaag
gatgaaacaacagcgttagaatataaaagggcgttgctcaatttgttagagaagtag

DBGET integrated database retrieval system