KEGG   Helicobacter pylori PeCan18: HPPC18_06390Help
Entry
HPPC18_06390      CDS       T02036                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hca  Helicobacter pylori PeCan18
Pathway
hca00260  Glycine, serine and threonine metabolism
hca00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hca01100  Metabolic pathways
hca01110  Biosynthesis of secondary metabolites
hca01130  Biosynthesis of antibiotics
hca01230  Biosynthesis of amino acids
Module
hca_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hca00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPPC18_06390 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPPC18_06390 (trpA)
Enzymes [BR:hca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPPC18_06390 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB ThiG
Motif
Other DBs
NCBI-ProteinID: AFI03006
UniProt: I0EJ87
Position
complement(1345832..1346620)
Genome map
AA seq 262 aa AA seqDB search
MRYQNMFETLKKQGKMAFIPFVTLGDPNYELSFEIVKTLIISGVSALELGLAFSDPVADG
TTIQASHLRALKHASMAKNFQLLKKIRGYNHDIPIGLLAYANLIFSYGVDGFYAQAKECG
VDSVLIADMPLIEKELVIKSAQKHQIKQIFIASPNASSKDLEQTATHSQGYIYTLARSGV
TGVSHTLENDASTIIKTLKAFSPTPALLGFGISKKEHITNAKEMGADGVICGSALVKIIE
ENLNNEDAMLEKIKGFVGGMIS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaggtatcaaaacatgtttgaaaccttaaaaaaacaaggaaaaatggcgtttatcccg
tttgtaaccttgggcgatcccaattatgaattgagttttgaaatcgttaaaaccctaatt
attagcggggtgagcgctttagaattgggtcttgctttttctgatcctgtagcggatggc
accaccatacaagcgagccatttaagggcgttaaaacacgctagcatggctaaaaatttc
cagcttttaaaaaagattagaggctacaaccatgatattcccatagggcttttagcgtat
gcgaatctcattttttcttatggcgttgatggtttttacgctcaagctaaagaatgcggt
gtggatagcgttttaatagcggacatgcccctaatagaaaaagaattggtcatcaaatcc
gctcaaaaacaccaaatcaaacaaatctttatcgccagccctaatgcgagcagtaaggat
ttagaacaaaccgctacgcattcgcaaggctatatctacactttagccaggagtggggtt
acaggggtgagccataccctagagaacgatgcaagcacgatcatcaaaaccttaaaagct
tttagccccactccagccttactgggctttggcatttccaaaaaagaacacatcacaaac
gctaaagaaatgggtgctgatggcgtgatttgcggatcagcgttagtcaaaatcatagaa
gaaaatttaaacaatgaagacgccatgctagaaaaaattaaggggtttgtaggaggaatg
atttcttaa

DBGET integrated database retrieval system