KEGG   Helicobacter pylori PeCan18: HPPC18_06395Help
Entry
HPPC18_06395      CDS       T02036                                 

Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hca  Helicobacter pylori PeCan18
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPPC18_06395
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPPC18_06395
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPPC18_06395
Enzymes [BR:hca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPPC18_06395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1346617..1347822)
Genome map
AA seq 401 aa AA seqDB search
MNQKAYFGEFGGSFVSELLVPALRELEQAFDACLKDEKFQKEYFRLLKDFVGRPSPLTLC
QNIVSNPKVKLYLKREDLIHGGAHKTNQALGQALLAKKMGKTRIIAETGAGQHGVATAIA
CALLNLKCVIFMGGKDIKRQEMNVFRMRLLGAEVREVNSGSATLKDAVNEALRDWASSYK
NTHYLLGTAAGPHPYPTMVKTFQKMIGDEVKSQILEKENRLPDYVIACVGGGSNAIGIFS
AFLNDKEVKLIGVEPAGLGLETNKHGATLNKGRVGILHGNKTYLLQDDEGQIAESHSISA
GLDYPGVGPEHSYLKEIGRAVYESASDIEALEAFSLLCQKEGIIPALESSHALAYALKIA
QKCTQESIIVVNLSGRGDKDLSTVYNALISTVYSALKGGLK
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaaaagcgtattttggggagtttggagggagttttgtgtcagagttgttagtg
cctgcattaagagagttagaacaggcgtttgatgcgtgtttgaaagatgaaaaattccaa
aaagagtattttcgtcttttaaaagattttgtgggccgtcctagccctttaaccttgtgt
caaaatatcgtttctaaccctaaagtcaagctttatttaaagcgagaggatttaatccat
ggcggggcgcataagactaatcaggccttagggcaagcccttttagcgaaaaaaatgggt
aaaacaaggattattgctgaaacgggtgctgggcagcatggcgttgcaacggctatcgct
tgcgcgttattgaacttaaaatgcgtgatttttatgggaggaaaagatatcaagcgtcag
gaaatgaatgtttttagaatgcgcttattgggcgctgaagtgagagaagttaattcaggg
agcgcgacgcttaaagacgccgtgaatgaggccttaagagattgggcgagcagttacaag
aacacgcactatttgctaggcacagccgccgggccgcacccttaccccacaatggttaaa
acctttcaaaaaatgataggcgatgaggttaaaagccaaattttagaaaaagaaaaccgc
ttacctgattatgtgatcgcatgcgttggaggggggtctaacgctatagggatattcagc
gcgtttttaaacgataaagaggtcaaactcataggcgtagagccagccggtttagggcta
gaaaccaataagcatggggcgactttgaataaggggcgtgtggggattttgcatgggaat
aaaacctatcttttacaagatgatgaaggccagattgcagaaagccatagcattagtgcc
gggcttgattatccaggagtggggccagaacacagctatttaaaagagattgggcgcgcg
gtttatgaaagcgcaagcgatattgaagcgctagaagccttcagtttgttgtgccaaaaa
gaaggcattatcccagcactagaaagctcacacgccttagcgtatgccttaaaaatcgct
caaaaatgcacgcaagaaagcattattgtagtgaatttaagcggtcggggggataaggat
ttaagcaccgtttataacgctttaataagcaccgtttatagcgctttaaaaggaggttta
aaatga

DBGET integrated database retrieval system