KEGG   Helicobacter pylori PeCan18: HPPC18_06400Help
Entry
HPPC18_06400      CDS       T02036                                 

Definition
(GenBank) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
hca  Helicobacter pylori PeCan18
Pathway
hca00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hca01100  Metabolic pathways
hca01110  Biosynthesis of secondary metabolites
hca01130  Biosynthesis of antibiotics
hca01230  Biosynthesis of amino acids
Module
hca_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hca00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPPC18_06400
Enzymes [BR:hca01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HPPC18_06400
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     HPPC18_06400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AFI03008
UniProt: I0EJ89
Position
complement(1347824..1349182)
Genome map
AA seq 452 aa AA seqDB search
MPSVLENILKDKLLEVSMLKKNHTLPANITPSDRDFKKALLEKRTSFILECKKASPSKGL
IRKDFDLLKIAKTYEKFASCVSVLADAKHFLGSYENIKIVSQHSTKPILCKDFIIDAFQI
KLARVMGSNAVLLMLSALDDKNYLELFNLAKSLNMSVLTEVSNQQEIERLLKLQYDIIGI
NNRDLHTLKTDIFHTLELRPLLPKDVLIISESGIYSHAQIKALAPYVNGFLVGSSLMAQK
DLKKACAKLILGENKVCGLTRIKDAKAVYKNHFIYGGLIFEKSSPRYIKPKEALKITKAV
KKLDFVGVFVKDKIKKIQKIAKKLDLKVVQLYGYSQKEIAQLKKALPKTCAIWQVVSVAD
SKDLAPKIQEASLILYDTKGDKMGGNGVSFDWEILENAKTPFMLAGGLNLDNIQKALKVK
ALGLDFNSGLEISPGIKNKDKIKQLARILREY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcctagcgtgttagaaaacatccttaaagacaaactcctagaagtctctatgcttaaa
aaaaatcacaccttgcccgcaaacataaccccaagcgacagggattttaaaaaagcgtta
ttggaaaaaaggacaagctttattttagagtgtaaaaaagcatcgccctccaaaggtttg
atcagaaaagattttgacttgttgaaaatagccaagacttatgaaaaatttgcctcttgc
gtttcagttttagccgatgctaaacattttttaggctcttatgaaaacattaagatcgtt
tcgcagcattccaccaagcccattttgtgtaaagattttatcattgacgcttttcagatc
aaactcgctagggttatgggatctaatgcggtgcttttaatgttaagtgcgttagatgat
aaaaactatttagagcttttcaacctcgctaaatccttaaacatgagcgttttaactgaa
gtttccaaccagcaagaaattgagcgcttgctcaaactccaatacgacattataggtatt
aataacagggatttacacaccttgaaaaccgatatttttcacacgctggaattacgcccc
ctgttgcctaaagacgtgctcattatcagtgagtccggtatttattcgcatgcgcaaatc
aaagccctagccccttatgtgaatggctttttagtgggtagctctttaatggcacaaaaa
gatttgaaaaaagcgtgcgctaaattgattctaggcgaaaataaagtgtgcgggcttaca
aggattaaagacgccaaagccgtttataaaaaccatttcatttatgggggtttgattttt
gaaaaatcttcgccccgatacatcaagcctaaagaagccttaaagatcacaaaagcggtt
aaaaaactggattttgtgggcgtgtttgtgaaagataaaattaaaaaaatccaaaaaatc
gccaaaaagcttgatttaaaagtggtgcagctttatggctattcgcaaaaagaaatcgct
caattgaaaaaagcgctccctaaaacttgcgcgatctggcaagtagtgagcgtggcggat
tctaaagatttagcgcctaaaattcaagaagcctctctgattttatacgacactaagggg
gataaaatgggaggcaatggcgtgagttttgattgggaaattttagaaaatgccaaaacg
cctttcatgttagctggtgggcttaatttggataacattcaaaaagccttgaaagttaaa
gcgttgggtttggatttcaattcaggtttagaaataagccccgggattaaaaataaggat
aaaatcaagcaattagcccgaattttaagagagtattaa

DBGET integrated database retrieval system