KEGG   Helicobacter pylori PeCan18: HPPC18_07295Help
Entry
HPPC18_07295      CDS       T02036                                 

Definition
cytochrome c551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
hca  Helicobacter pylori PeCan18
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1522476..1523528)
Genome map
AA seq 350 aa AA seqDB search
MKKSILLGVCLAFSCVYALSDMDLIKKAKESQLEPMPMGKALKEYQIKKTRDVGIGAKNS
EIMTSAQVELGKMLYFDPRISTSYLVSCNTCHNLGLGGVDLIPSAIGSQWKKNPHLLSSP
TVYNSVFNDVQFWDGRVTHLNEQAQGPIQSSFEMGADPKVVVEKINSIPGYVKLFRKAYG
SKVKIDFKLIADSIAMFEATLITPSRYDDFLRGNPKALSKAEKEGLDLFISKGCVACHNG
INLGGTMQPFGVVKPYKFANVGDFKGDKNGLVKVPTLRNITETMPYFHNGQFWDVKDAIK
EMGSIQLGIEISDAEAKKIETFFEALKGKKPKIIYPELPVMTDKTPKPSF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatccattttattgggcgtttgcttggctttttcttgcgtttatgctttaagc
gatatggatttgattaaaaaagcgaaggaaagccaattagaacccatgcctatgggcaaa
gcactcaaagaataccagatcaaaaaaaccagagatgtgggcattggcgctaaaaacagc
gaaatcatgacctccgctcaagtggaattaggcaaaatgctctattttgaccctaggatt
tccacttcctatcttgtgtcttgcaacacatgccataatctgggcttaggcggggtggat
ctaatcccaagcgctataggctctcaatggaagaaaaacccccaccttttaagctcccca
acggtgtataactccgtgtttaacgatgtgcagttttgggatggtagggttacgcattta
aacgagcaagcgcaagggccaatccaatcttcttttgaaatgggggctgaccctaaagtg
gtggtagaaaaaatcaattccataccaggctatgtcaagctctttagaaaagcttatggc
tctaaagtcaaaattgattttaaattgatcgctgatagtatcgctatgtttgaagccacg
ctcatcaccccaagccgctatgatgattttttaaggggcaatcctaaagcgctcagtaaa
gccgaaaaagaagggttggatttattcatttctaaaggctgtgtggcgtgtcataatggc
atcaatcttgggggaacgatgcagccttttggggtggtcaaaccttataaattcgctaat
gtgggcgatttcaaaggcgataaaaacgggcttgtgaaagtgcctactttaaggaatatc
accgaaacgatgccttatttccataacgggcagttttgggatgttaaggatgcgattaaa
gaaatgggctctatccagttaggcattgaaatcagcgatgcagaagcgaaaaaaattgaa
accttctttgaagccttaaagggtaaaaaacctaagataatctatccagaactccctgtg
atgacagacaaaacccctaaaccctctttttga

DBGET integrated database retrieval system