KEGG   Helicobacter cinaedi ATCC BAA-847: HCBAA847_0738Help
Entry
HCBAA847_0738     CDS       T02494                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hcb  Helicobacter cinaedi ATCC BAA-847
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hcb00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(719015..719767)
Genome map
AA seq 250 aa AA seqDB search
MADSVLLTSKSYNPLATRAYEVVLIGTREVKNVKCLVTNKITYLPITHDLQGIDSLIFTS
RYAIRALLESANPLSPHYNPHLAKWREIPSFVISPKSAEILYQHNAKVEFVGQKAHGQEF
AKEIIPLLQNRFPIYLRAKEIVSQLNATLINAKVPLQEVIAYVNTPLTLEQNLKPKPQSV
LIFTAPSAYKSFVANFSWEYEYIAIAIGKSTFASFSPTLQAYISPKPSIPHAIEFAKSIA
LGLNTQNARK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcagattcagtattgcttacaagcaaatcctataatccccttgccactcgtgcctac
gaagttgtgcttataggcacacgcgaagtaaaaaatgtcaaatgccttgttacaaataaa
atcacctatctgcctatcacacacgatttacaaggcattgatagtcttatttttacttca
cgctacgctatacgagccctgctagaatctgccaaccccctatccccacactacaatcca
catcttgctaagtggcgtgagattccaagctttgtgataagcccaaagagtgcggagatt
ctctatcagcataacgcaaaggtggagtttgtagggcaaaaagcgcacgggcaagaattt
gctaaagagattatccccctgcttcaaaatcgctttccaatctatctacgcgccaaagag
attgtctcacagcttaatgccacacttataaatgccaaagtcccgctgcaagaagtcata
gcttatgtgaatacacccttaactttagagcagaatcttaagccaaaaccgcaaagcgtg
ttaatcttcaccgcaccaagtgcgtataaaagctttgtagcaaattttagctgggaatat
gagtatatcgctattgccattggtaaaagcacctttgcttcttttagccccacacttcag
gcttacattagcccaaagcctagcattccccacgctattgagtttgctaaatccatagcc
ttagggctaaatacccaaaatgcaagaaagtag

DBGET integrated database retrieval system