KEGG   Helicobacter cinaedi ATCC BAA-847: HCBAA847_0912Help
Entry
HCBAA847_0912     CDS       T02494                                 

Definition
phosphoenolpyruvate phosphomutase (EC:5.4.2.9)
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
hcb  Helicobacter cinaedi ATCC BAA-847
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hcb00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    HCBAA847_0912
Enzymes [BR:hcb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     HCBAA847_0912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
881632..882945
Genome map
AA seq 437 aa AA seqDB search
MAADLIHPGHINILKIARELADSLESSEGRRGEVVLGLLTDKAIASYKRLPYMNYAQRYE
VISHLKEIDRVIPQDTLSYEGNIRSLKPRFVIHGDDWKSGTQSKTRQNVIDTLQELNCGE
LIEPSYTEGISSTQLNLDARAIGISTNARLSLLRRLVNAKTPLRICETHSAISALIAQNA
CVESSGKKLEFDGFWSSSLTDSTSRGKPDIEAVELTSRLNTINEIFEVTSKPLIYDADTG
GKIEHFVFSVRSLERTGVSAVIIEDKTGLKKNSLLGNDVEQTQEDIEVFCDKIRAGKNAR
ITQDFMIIARIESLILDKGQEDALKRAFAYINAGADGIMIHSRQKSPDEVLAFLKTFREK
DSKTPVVVVPTSFNEITAKELGEAGANIIIYANHLLRASFVAMQKVSQGILEFDRSKEME
SSCMSVKEILSLIPGTI
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagatttaatccaccccggacacattaatatcctaaaaatcgcaagagagtta
gccgatagcttagaatctagtgagggcagaaggggcgaagtcgtgctaggacttttgacc
gataaggcaatagcctcttataaacgactaccttatatgaactatgcccaacgctatgaa
gtcattagccatttaaaagagattgatagagttatcccgcaagatacattgagttatgag
ggcaatatccgctccttaaagcctcgcttcgtaatccacggcgatgattggaaaagcggc
acacagagtaaaacgcgtcaaaatgtcattgataccctgcaggagctaaattgcggtgag
cttatagagcctagctacacagagggcataagctccacacagctaaaccttgatgcaagg
gcgattggcatcagcacaaatgctagactttcgctcttacgccgacttgtgaatgcaaaa
actccacttagaatctgtgaaacccactccgctatatccgcccttatcgcacaaaatgct
tgtgtagaatctagcggcaaaaagctagagtttgatggcttttggagttctagccttaca
gatagcacaagcaggggtaagccagatattgaagccgtagagctaacaagccgcttaaac
accattaatgaaatctttgaagtaacctcaaagcccttgatttatgatgctgacacaggt
ggcaagatagagcattttgtcttttctgtgagaagtttggagcgaacgggagtatctgct
gtcatcattgaagacaaaacgggcttaaagaaaaattcacttttgggtaatgatgtagag
caaacccaagaagacattgaagtcttttgcgacaagattagagcagggaaaaacgcacgg
attacacaggattttatgattatcgcgcgtattgaatctttgatactagacaaagggcaa
gaagatgcactaaaaagggcttttgcctatattaacgctggggcagatggtataatgata
cattcacgccaaaaaagccctgatgaagtgttagcttttctcaaaacctttagagagaaa
gattctaaaacgcctgtggtagtcgtgcctacaagctttaatgaaatcactgcaaaagag
ctaggggaagcaggggcaaatattatcatttatgcaaaccacttgcttagggcttcattt
gtagcgatgcaaaaggtctcacaagggattttagagtttgatagaagtaaggagatggaa
tcttcttgtatgagtgtgaaggagattctctcacttattccggggacaatttag

DBGET integrated database retrieval system