KEGG   Helicobacter cinaedi ATCC BAA-847: HCBAA847_1187Help
Entry
HCBAA847_1187     CDS       T02494                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hcb  Helicobacter cinaedi ATCC BAA-847
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1160716..1161411)
Genome map
AA seq 231 aa AA seqDB search
MKTKIAISMLCALSVAYSAADKAELQKTLQANSVQGSIISSSDLASGLSMIIIDVNNQQV
PFLATNDGKFIFEPNALLIQDKAVQTKIQGFYKDFYEKEKAKINIKLQEVFKKQSANVFH
FKSQKNGAKTIYVVSDANCPYCQKEFANLNKRLEDANVELLVVGFLGEDSMLKAANALKN
KSGNQAKDIAMLAKLYEPKRKATSMDTKLAQELTQAVADTGVRSVPYIIED
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaaaattgctataagtatgctgtgtgctttgagtgtggcgtatagtgcggcg
gataaggcggagctgcaaaagactttacaggctaattccgtgcaggggagcattatctca
agcagtgatttggcaagtgggctaagtatgataatcattgatgtgaataatcagcaagtg
ccatttctagcgacaaatgatgggaagtttatctttgagcctaatgcgttgcttatacag
gataaggcggtgcagactaagattcagggattttataaagatttttatgagaaagaaaag
gcaaagattaatattaagttgcaagaggtgtttaaaaagcaaagtgccaatgttttccac
tttaaatctcaaaaaaatggggcaaagacgatttatgtcgtctctgatgcgaattgccct
tactgccaaaaggagtttgcaaatttgaataaacggctagaagatgccaatgtagagctt
ttagtcgttggctttttgggcgaagattctatgctgaaggctgctaatgcgttgaaaaac
aaaagtggcaatcaagctaaagatattgcgatgttagccaaactctatgagccaaaaaga
aaagctacaagtatggatacgaaactagcccaagagctcacacaagctgtggctgatacg
ggtgtgcgttccgtgccttatattatcgaagattag

DBGET integrated database retrieval system