KEGG   Helicobacter cinaedi ATCC BAA-847: HCBAA847_2078Help
Entry
HCBAA847_2078     CDS       T02494                                 

Definition
L-fuculose-1-phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hcb  Helicobacter cinaedi ATCC BAA-847
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hcb00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1954173..1954802
Genome map
AA seq 209 aa AA seqDB search
MNIHTTQVSQELIQNIANVSLSLFRKNFFGIFHGAISARVSKNRFIINKQNAIFDNINAD
SMIMLYQKQDYRWNEASLHAPIHAAIYESFSEAKFIAYAMPPYLVSYTLKYDKLEPKDYF
GYKFLAPSVEIFDPKDYESWAERADTDIPRYFKEHSHSFMLIKGYGVYVYARDLHTLAKI
IALIENSCKILHYNADLGEIFETSAKYDV
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccataccactcaagtaagccaggagcttatacaaaacatcgctaatgtctct
ctttcactctttaggaagaacttttttggaatctttcacggggcgatttctgcgcgtgtg
agtaaaaaccgctttattatcaacaaacaaaatgctatttttgacaatatcaacgcagat
tctatgattatgctctatcaaaagcaggactatcgctggaatgaggcaagtctgcacgcc
cccattcacgcagcaatttatgagagcttttctgaagcaaagtttatcgcctatgctatg
ccgccttatcttgtgtcttatacgcttaaatacgacaagctagagccaaaggattatttt
ggatataaatttttagccccgagtgttgagatttttgaccctaaggattatgagagctgg
gcggaacgcgctgatacggatattccacgatattttaaggagcattcccatagctttatg
ctgattaaaggctatggcgtgtatgtgtatgctagggatttacacacattagccaagatt
attgccttaattgaaaattcgtgtaagattctgcattacaacgccgatttgggcgagatt
tttgaaacgagtgcgaaatatgatgtctaa

DBGET integrated database retrieval system