KEGG   Helicobacter cinaedi ATCC BAA-847: HCBAA847_2078Help
Entry
HCBAA847_2078     CDS       T02494                                 

Definition
L-fuculose-1-phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hcb  Helicobacter cinaedi ATCC BAA-847
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hcb00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HCBAA847_2078
Enzymes [BR:hcb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     HCBAA847_2078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1954173..1954802
Genome map
AA seq 209 aa AA seqDB search
MNIHTTQVSQELIQNIANVSLSLFRKNFFGIFHGAISARVSKNRFIINKQNAIFDNINAD
SMIMLYQKQDYRWNEASLHAPIHAAIYESFSEAKFIAYAMPPYLVSYTLKYDKLEPKDYF
GYKFLAPSVEIFDPKDYESWAERADTDIPRYFKEHSHSFMLIKGYGVYVYARDLHTLAKI
IALIENSCKILHYNADLGEIFETSAKYDV
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccataccactcaagtaagccaggagcttatacaaaacatcgctaatgtctct
ctttcactctttaggaagaacttttttggaatctttcacggggcgatttctgcgcgtgtg
agtaaaaaccgctttattatcaacaaacaaaatgctatttttgacaatatcaacgcagat
tctatgattatgctctatcaaaagcaggactatcgctggaatgaggcaagtctgcacgcc
cccattcacgcagcaatttatgagagcttttctgaagcaaagtttatcgcctatgctatg
ccgccttatcttgtgtcttatacgcttaaatacgacaagctagagccaaaggattatttt
ggatataaatttttagccccgagtgttgagatttttgaccctaaggattatgagagctgg
gcggaacgcgctgatacggatattccacgatattttaaggagcattcccatagctttatg
ctgattaaaggctatggcgtgtatgtgtatgctagggatttacacacattagccaagatt
attgccttaattgaaaattcgtgtaagattctgcattacaacgccgatttgggcgagatt
tttgaaacgagtgcgaaatatgatgtctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system