KEGG   Helicobacter cinaedi ATCC BAA-847: HCBAA847_2091Help
Entry
HCBAA847_2091     CDS       T02494                                 

Definition
DNA ligase (EC:6.5.1.-)
Orthology
K10747  
DNA ligase 1 [EC:6.5.1.1]
Organism
hcb  Helicobacter cinaedi ATCC BAA-847
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:hcb00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    HCBAA847_2091
   03410 Base excision repair
    HCBAA847_2091
   03420 Nucleotide excision repair
    HCBAA847_2091
   03430 Mismatch repair
    HCBAA847_2091
Enzymes [BR:hcb01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     HCBAA847_2091
DNA replication proteins [BR:hcb03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (archaeal)
    Other elongation factors
     HCBAA847_2091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1967371..1968207
Genome map
AA seq 278 aa AA seqDB search
MKHTLFRALLYGLLLWGVALYAKAFEPMLLSEFEKRQANSQWLVSEKLDGVRGLWNGQKM
YFRSGKPMNLPSEFMKDFPPFALDGELYSPKLHFSQIISILKNPQKQNEILELKFYVFDV
PHSAKDSLTQRLDELRTYLKSKPNVYIEIIPQRLMQGQDSIDRELQAVVDNGGEGLVLRT
PNMPYQKGRSKYDFKLKTRQDAECKVIGHTQGKGKYDSMLGAIICEYNGKNFKIGSGLSD
TLRHNPPPIGSIISFKFQGLTHNGTPRFPTFWRIKQEE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacacactttttagggctttgctttatggcttactgctatggggagtagccctc
tacgcaaaagcttttgagcctatgcttttaagtgagtttgaaaaaagacaagcaaattct
caatggcttgtaagtgaaaagcttgatggtgtgcgagggttatggaatgggcaaaagatg
tatttccgcagtggcaagccaatgaatctgccaagtgagtttatgaaagattttccgcct
tttgcccttgatggtgagctatatagcccaaaactccacttctctcaaattatctctatc
cttaaaaatccgcaaaagcaaaatgaaattttagagttaaaattttatgtttttgatgtg
ccgcattccgctaaagattcactcacgcaaaggcttgatgagctaaggacatatcttaag
tctaagccaaatgtgtatattgagataatcccccaaaggcttatgcaagggcaggattct
attgatagggagcttcaagcggttgtggacaatggtggagagggacttgtcttgcgaacg
ccaaatatgccctatcaaaaaggacgaagcaaatatgattttaagctcaaaacaaggcag
gacgcggaatgtaaggtcataggacacacgcaaggtaagggtaagtatgattctatgcta
ggagcgattatttgtgaatacaatggcaaaaactttaaaatcggcagtggcttgagcgat
acgctaaggcacaatcctccgcccattggttcaatcattagctttaagtttcaagggctt
acacacaatggcactccacgcttcccaaccttttggcgtataaaacaagaagaataa

DBGET integrated database retrieval system