KEGG   Helicobacter cinaedi ATCC BAA-847: HCBAA847_2091Help
Entry
HCBAA847_2091     CDS       T02494                                 

Definition
DNA ligase (EC:6.5.1.-)
Orthology
K01971  
DNA ligase (ATP) [EC:6.5.1.1]
Organism
hcb  Helicobacter cinaedi ATCC BAA-847
Pathway
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:hcb00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    HCBAA847_2091
   03420 Nucleotide excision repair
    HCBAA847_2091
   03430 Mismatch repair
    HCBAA847_2091
   03450 Non-homologous end-joining
    HCBAA847_2091
Enzymes [BR:hcb01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     HCBAA847_2091
DNA repair and recombination proteins [BR:hcb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      HCBAA847_2091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1967371..1968207
Genome map
AA seq 278 aa AA seqDB search
MKHTLFRALLYGLLLWGVALYAKAFEPMLLSEFEKRQANSQWLVSEKLDGVRGLWNGQKM
YFRSGKPMNLPSEFMKDFPPFALDGELYSPKLHFSQIISILKNPQKQNEILELKFYVFDV
PHSAKDSLTQRLDELRTYLKSKPNVYIEIIPQRLMQGQDSIDRELQAVVDNGGEGLVLRT
PNMPYQKGRSKYDFKLKTRQDAECKVIGHTQGKGKYDSMLGAIICEYNGKNFKIGSGLSD
TLRHNPPPIGSIISFKFQGLTHNGTPRFPTFWRIKQEE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacacactttttagggctttgctttatggcttactgctatggggagtagccctc
tacgcaaaagcttttgagcctatgcttttaagtgagtttgaaaaaagacaagcaaattct
caatggcttgtaagtgaaaagcttgatggtgtgcgagggttatggaatgggcaaaagatg
tatttccgcagtggcaagccaatgaatctgccaagtgagtttatgaaagattttccgcct
tttgcccttgatggtgagctatatagcccaaaactccacttctctcaaattatctctatc
cttaaaaatccgcaaaagcaaaatgaaattttagagttaaaattttatgtttttgatgtg
ccgcattccgctaaagattcactcacgcaaaggcttgatgagctaaggacatatcttaag
tctaagccaaatgtgtatattgagataatcccccaaaggcttatgcaagggcaggattct
attgatagggagcttcaagcggttgtggacaatggtggagagggacttgtcttgcgaacg
ccaaatatgccctatcaaaaaggacgaagcaaatatgattttaagctcaaaacaaggcag
gacgcggaatgtaaggtcataggacacacgcaaggtaagggtaagtatgattctatgcta
ggagcgattatttgtgaatacaatggcaaaaactttaaaatcggcagtggcttgagcgat
acgctaaggcacaatcctccgcccattggttcaatcattagctttaagtttcaagggctt
acacacaatggcactccacgcttcccaaccttttggcgtataaaacaagaagaataa

DBGET integrated database retrieval system