KEGG   Helicobacter cetorum MIT 00-7128: HCW_01655Help
Entry
HCW_01655         CDS       T02032                                 

Definition
cytochrome c551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
hce  Helicobacter cetorum MIT 00-7128
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(329188..330249)
Genome map
AA seq 353 aa AA seqDB search
MKKSVLFGVTAFCVAFSFAHATNDLALIKKARESHLEPMPIGKALREYQIKKTKDVGIGG
NDSNVMTQAQVELGKMLYLDPRISTSYLVSCNTCHNLGLGGVDLAPKAVGAQWKSNPHFL
NSPTVYNSVFNDVQFWDGRVTHLGEQAQGPIQAPFEMGADPKVVVEKINSMPGYVKLFKK
AYGNKVKIDFKLITDTIAMFEATLVTPSRYDDFLRGNPKALSKAEQEGLEVFIEKGCVGC
HNGINLGGSMQAFGVVKPYKFANVGDFKGDKNGMVKVPTLRNITETMPYFHNGQYWDVKD
AIKEMGSIQLGVEISDEEAKKIETFFGALKGKKPKIVYPELPTITDKTPKPSF
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatcggttttgtttggcgttacggcgttttgcgtggcgttttcttttgcgcat
gcaaccaatgacttagcattgattaaaaaggctagagaaagtcatttagagcctatgcct
ataggtaaggcacttagagaataccaaatcaaaaaaactaaagatgtaggtattgggggc
aatgattctaatgtaatgactcaagctcaagtagagttaggtaaaatgctctatttagac
cctagaatttctacttcttacttggtgtcttgtaacacttgccataacttagggcttggt
ggcgtggatttagcccctaaagctgtaggcgctcagtggaagagcaatccccacttttta
aactctccaactgtgtataactcagtttttaatgatgtgcaattttgggatggtagggtt
acgcatttaggcgagcaagctcaaggacctatccaagctccttttgaaatgggcgctgac
cctaaagttgtagtagaaaaaatcaattctatgcccggctatgtgaagttattcaaaaaa
gcttatggcaataaagtaaagattgatttcaagcttatcactgatactattgcaatgttt
gaggctactttagtaactccaagcagatacgatgatttcttaaggggtaaccctaaagcc
ttaagcaaagcagagcaagagggcttagaagtatttattgaaaagggttgtgtgggttgt
cataatggcattaatttgggtggttctatgcaagcctttggcgtggttaagccttataag
tttgctaatgtaggcgatttcaaaggggataaaaacggcatggttaaagtgccaactcta
agaaatatcacagagactatgccttatttccataacggacaatattgggatgttaaagat
gcgattaaagaaatgggctctatccaattaggtgttgaaattagcgatgaagaagctaag
aaaattgagactttctttggtgccttaaagggcaaaaaacctaagattgtttatccagaa
ctccctacaatcactgataaaaccccaaaaccctctttttaa

DBGET integrated database retrieval system