KEGG   Helicobacter cetorum MIT 00-7128: HCW_01720Help
Entry
HCW_01720         CDS       T02032                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hce  Helicobacter cetorum MIT 00-7128
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:hce00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(341805..342602)
Genome map
AA seq 265 aa AA seqDB search
MQFSFEVYPKVNIFLKILQKEGTYHKLISRLVLTNLMRDFINIKTAHSFSLKGDFDCPLE
ENTIFKALQALKNYLKQKDFPKSKLNPLNTLSIEIEKHIPAQAGLGGGSADAGNLLYFLN
QAFEFGLNLEELYVIGSSIGMDVNFFISQYTSANVTSYGEVIEAFDEEPLEIGNIQIPKG
ITCNTKSIYQAYRPSACHSKIDTQAWLKKPSLECLKTHSRHELNDLLKPALQINPALKEF
ESALGKDWFFSGSGSAFFYAMGVED
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgcaattttcttttgaagtctatcctaaagtcaatattttcttaaaaatcttacaaaaa
gaaggcacatatcacaaactcatctctcgcctagttttaacgaaccttatgagggatttt
atcaatattaaaacagctcattcattcagtctcaaaggcgattttgattgccccttagaa
gagaatactatttttaaagcccttcaagcattaaaaaactacttaaaacaaaaagatttt
ccaaaatcaaaactaaatcctttaaacaccctatctattgaaatagaaaaacacattcct
gctcaagcgggtttaggcggagggagtgctgatgcgggcaatttgctttatttcttaaat
caagcttttgaatttggtctgaatttagaagagctttatgttattggttcttcaataggc
atggatgtgaatttttttatctcacaatacacaagcgctaatgtaacttcttatggcgaa
gtgattgaggcttttgatgaagaacctttagaaatagggaacattcaaatccctaaagga
ataacttgcaataccaaatccatctatcaagcttatcgccctagtgcttgtcattctaag
attgacacacaagcttggctcaaaaagcctagccttgaatgcctaaaaactcattctagg
cacgagcttaacgaccttttaaagccagcattacaaattaatcctgctttaaaagaattt
gagagtgcattaggaaaagattggttttttagtgggagtgggagcgcatttttttatgca
atgggggtagaagattag

DBGET integrated database retrieval system