KEGG   Helicobacter cetorum MIT 00-7128: HCW_02300Help
Entry
HCW_02300         CDS       T02032                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hce  Helicobacter cetorum MIT 00-7128
Pathway
hce00260  Glycine, serine and threonine metabolism
hce00750  Vitamin B6 metabolism
hce01100  Metabolic pathways
hce01110  Biosynthesis of secondary metabolites
hce01120  Microbial metabolism in diverse environments
hce01230  Biosynthesis of amino acids
Module
hce_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hce00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HCW_02300
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HCW_02300
Enzymes [BR:hce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HCW_02300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AFI03741
UniProt: I0ELC2
Position
complement(468864..470318)
Genome map
AA seq 484 aa AA seqDB search
MPFIPTRTNKAKDVSFIDALLNPSAPKGGLYTIEDFKPLDWQYCLNCSYMQLVEHVFECL
NLEVPKDMLKKALERYENFDNPSNPAPIFALNERLFVQELYHGPSLAFKDMALQPFGSLL
SSLAVEKNKRFLVLVSTSGDTGPATLESLANMPNIFVVCLYPKDGTSLVQQLQMTTQNAK
NLKIFGIEGNFDDAQNALKELLKDEDFKEILKAQHLELSVANSVNFGRIAFQIVYHIWGY
LELYRKGALSAKEPIVLAIPSGNFGNALGAYYAKMMGLPLSSIKIVTNANDVLKEFIQTG
RYNLQSRSLLKTYSPAMDILKSSNVERLLYALFGVERTNECMKSLEDYQYYNLMPNELKR
LQESFSSASCSDSDCLKTIQEVYAEHHYLIDPHTATALYASLHSEEKTLISSTASYEKFP
STTLSALTKQQKNDRGALDTLRCCYDAPSSKRLDDLFQRDVKHQEILRLHTIKPSILSWL
ESLS
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgccttttatccccactcgcactaataaagctaaagatgtaagctttatagatgcttta
ttaaatcctagtgcgcctaaaggcggactttatactatagaggattttaagcccctagat
tggcaatattgtttgaattgtagctatatgcaattagtagagcatgtatttgaatgctta
aatttagaagtgccaaaagatatgttaaaaaaggctttagagcgctatgaaaattttgat
aacccctctaaccccgcccctatttttgcgctcaatgaaaggctatttgtccaagagctc
tatcatgggccaagccttgcgtttaaagatatggcattacaaccttttggtagcctactc
tctagcctagctgtagaaaagaataagcgctttttagtgctagtctctacaagtggtgat
acaggcccagcaactttagaaagcctagcgaatatgcccaatatttttgtagtttgtttg
tatccaaaagatggcacaagccttgtgcaacaattacaaatgacaacccaaaacgctaaa
aatcttaaaatttttggcatagaagggaactttgatgatgctcaaaatgccttaaaagag
cttttaaaagatgaggattttaaagagattttaaaggctcaacacctagaattaagcgtg
gcaaattccgtgaattttgggcgcattgcctttcaaattgtctatcatatttggggttat
ttagagctatatagaaagggagcgcttagcgctaaagaacccatcgttttagccatacct
agcgggaattttggaaatgctctaggggcttattatgccaaaatgatgggcttacctctt
tctagtattaaaattgtaactaacgctaatgatgtcttaaaagaatttatacaaaccggt
cgttataatttgcaatctcgctctttattaaagacctattcgccagctatggatattcta
aaaagctctaatgtggagcgcttgctttatgcgctttttggagttgagcgcacgaatgaa
tgcatgaaatctttagaagattaccaatattataatctaatgcctaatgagttaaaacgc
ttgcaagagagttttagctcagcttcttgctctgatagtgattgcttaaaaaccattcaa
gaagtttatgcagaacaccactatttaattgacccacataccgcaactgcgctatatgcg
agtctacatagtgaagaaaaaacgctcatttcttctaccgcctcttatgagaaattccca
agcaccactttaagtgcgctcaccaagcaacaaaagaatgatagaggcgcactagatacg
cttagatgttgttatgatgccccctctagcaagcgccttgatgatttattccaaagagat
gttaaacatcaagaaattctaagacttcacactattaagccctctatcctctcatggcta
gagagtttaagctaa

DBGET integrated database retrieval system