KEGG   Helicobacter cetorum MIT 00-7128: HCW_02625Help
Entry
HCW_02625         CDS       T02032                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hce  Helicobacter cetorum MIT 00-7128
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hce00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HCW_02625
Enzymes [BR:hce01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     HCW_02625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(549454..550596)
Genome map
AA seq 380 aa AA seqDB search
MTLKRLNPNALKTALHNIGSEKIAQAHMLKKGVSLVFEIKDLPLSATLILKQEALSVGGD
FATPKDCILAKKPFYDGILIVNAKQLERLITKCYSQPFGLKTLAQELKNHLKSPKPNAPQ
IMAILNLTPDSFYEKSRFDNKNAIEEIYQHLEKGITLIDIGAASSKPGSEIIDPKIEQKR
LKEVLYEIKSQKLYEHAKFSIDTYHASTAKMALEHHFSVLNDVSGFSSVEMLEVARDYKP
TCVLMHAKKTPKDMQENVFYHNLFDEMDIFFKDKLEILEKYALKDIILDIGFGFAKLKEH
NLALIKHLSHFLKFKKPLLVGASRKNTIGLITGREVEKRLSGTLALHLMALQNGASILRV
HDVDEHIDLIKVFNSLEESI
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgactttaaaacgccttaatcctaacgccttaaaaaccgcccttcacaacataggctca
gaaaaaatcgctcaagctcatatgcttaaaaaaggcgttagtttagtctttgaaatcaaa
gatttgcccctaagcgctacgcttattttaaaacaagaagccttgagtgtggggggtgat
tttgccacgccaaaagattgtatcctagccaaaaagcctttttatgatggcattctcatt
gttaatgccaaacaattagaacgccttatcaccaagtgttattcccaaccctttgggctt
aaaactctagcacaagaattaaaaaatcatctcaaatcccccaagcctaacgccccacaa
attatggcaattttaaatctcacgcctgatagtttctatgaaaagagccgttttgataat
aaaaatgccattgaagaaatctatcaacaccttgaaaaaggcatcactctcattgatata
ggtgcagcaagctcaaaacccggaagtgaaatcattgacccaaagatagaacagaagcgt
ttgaaagaagtcttatatgaaatcaaatctcaaaaactctatgaacatgctaaatttagt
atagacacctatcatgcaagcacagccaaaatggctttagaacaccatttttctgttctt
aatgatgtgagcggttttagtagcgttgaaatgctagaagtcgcaagagactacaagcca
acttgtgttttaatgcatgccaaaaaaactcccaaagacatgcaagaaaatgtcttttat
cacaacttatttgatgaaatggatattttctttaaagacaaactagagattttagaaaaa
tacgcccttaaggatattattttagatatagggtttggatttgccaaactaaaagagcat
aatctagccttaatcaagcacttaagccactttctaaaatttaaaaagcccttgctagtt
ggggcaagccgtaaaaacactatcggtcttattacagggcgtgaagttgaaaagcgactt
tctggcactttagctttgcatttaatggcattacaaaatggagcgagcattttaagagtg
catgatgttgatgagcatatagatttaatcaaagtgtttaatagcctagaagaaagtatc
taa

DBGET integrated database retrieval system