KEGG   Helicobacter cetorum MIT 00-7128: HCW_02990Help
Entry
HCW_02990         CDS       T02032                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hce  Helicobacter cetorum MIT 00-7128
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:hce01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hce01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hce00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hce00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
617307..618008
Genome map
AA seq 233 aa AA seqDB search
MKIAMANFKSAMPILKSHKYLQDLEKSLEPQHFDRVFVFPDFLGLLPNAFLHFTLGAQNA
YPKDLGAFTGEITSKHLEELKISTLLIGHSERRTLLNESPNFLKEKFDFFKNKNFKIVYC
IGEDLQTREKGLGAVKEFLNKQLEIIDTNYQNLMVAYEPIWAIGTGRSASVEDIYLTHNF
LKQNLNPKTPLLYGGSVNISNAQEILSIDSVDGLLIGSASLELENFKTIISFL
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgctatggctaattttaaatccgctatgcctattcttaagagtcataagtat
ttgcaagacttagaaaaaagtttagagccacagcattttgatagggtctttgtattccct
gattttttagggttgttgcctaatgcatttttgcatttcactttgggagcgcaaaacgct
taccctaaagatttaggagcctttacaggagaaattacttcaaagcatttagaagaatta
aaaatcagcacgcttttaattgggcatagcgaaagacgcacgcttttaaatgaaagccct
aattttttgaaagaaaaatttgatttttttaaaaataagaattttaagattgtctattgc
attggcgaagatttacaaactagggaaaagggcttaggggcggttaaagaatttttaaat
aagcaattagagataattgacacaaattatcaaaatttaatggtggcttatgagcctata
tgggcgattggcacaggaagaagtgcgagtgtagaagatatttatctcacgcataacttt
ttaaagcaaaatttaaatccaaaaacccctttgttgtatggtggaagtgtgaatataagt
aacgcacaagaaatcttaagcattgatagcgtagatggcttgttgattgggagtgcgtct
ttagaattagaaaattttaaaacaatcatttcatttttataa

DBGET integrated database retrieval system