KEGG   Helicobacter cetorum MIT 00-7128: HCW_03585Help
Entry
HCW_03585         CDS       T02032                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hce  Helicobacter cetorum MIT 00-7128
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hce00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HCW_03585
Enzymes [BR:hce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     HCW_03585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
752368..752859
Genome map
AA seq 163 aa AA seqDB search
MREILLTRFFPSDSKARVHFKNRVVLGLGANMKNPLKTLEQCYLWLKNHSAIGKVFSSPI
YLNPPFGYLKQAPFYNATLVLRTSLNLRKFFALVFYVERRFGRKRKREFKDAPRTLDIDI
IAFNKIVLNQAYLTLPHPKWSERESVLVPLALQQVLVKKGGLG
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgcgagagattcttttgacccgtttttttccaagtgattctaaagctagagtgcatttc
aaaaatagggttgtgttaggacttggtgctaatatgaaaaatcctttaaaaactttagag
caatgctacttatggcttaagaatcatagcgctataggcaaagttttttcttcgcctatt
tatctaaaccctccttttggctatctcaaacaggctcctttttataatgcgacccttgtg
cttagaacgagtttgaatttgcgtaaattctttgctttagttttttatgtagagaggcgt
tttggacgcaagagaaagcgtgagtttaaagatgctccaagaaccttagatattgatatt
atagcctttaataaaattgttttaaatcaagcttatttaactttgcctcaccctaaatgg
agtgagcgagagtctgtattagtgcctttagcgttgcaacaagtccttgtaaagaaaggg
ggattagggtga

DBGET integrated database retrieval system