KEGG   Helicobacter cetorum MIT 00-7128: HCW_03880Help
Entry
HCW_03880         CDS       T02032                                 

Definition
phospholipase A1
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
hce  Helicobacter cetorum MIT 00-7128
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hce00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    HCW_03880
   00565 Ether lipid metabolism
    HCW_03880
   00590 Arachidonic acid metabolism
    HCW_03880
   00591 Linoleic acid metabolism
    HCW_03880
   00592 alpha-Linolenic acid metabolism
    HCW_03880
Enzymes [BR:hce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     HCW_03880
    3.1.1.32  phospholipase A1
     HCW_03880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(822043..823092)
Genome map
AA seq 349 aa AA seqDB search
MRIKFLCFFLIACQLQGKKSDLDYDYYLRKQDLHLIRTKNNLDNAWYLAPKETPKEKSWA
RFAKRYLELIDYQGTYFLPIYHSFTPIYEWYHPNINPYQRNDFKFQISFKMPVFKHLLWT
KGTLFLAYTQTNWFQIYNDPQSAPMRMVNYMPELIYVYPINFEPFGGKIGNFAELWIGWQ
HISNGVGGAACYQPFSQGKPENQFPGQPVEVKDYNGQKNVRWGGCRSVSAGQRPVFRLVW
KKGGLKIMVAYWPYIPYNQSNPNLIDYMGYGNAKIDYRRGRHHFELQLYDIFTQYWRYKR
WHGAFRLGYTYRINPYVGIYAQWFNGYGDGLYEYDVYSNRLGIGIRLNP
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcgcataaaatttttatgtttttttctcatagcttgccaattacaaggcaaaaaatct
gatttagactatgattattatttacgcaaacaagatttacatcttattagaactaaaaat
aatttagacaacgcttggtatcttgccccaaaagaaactcctaaagaaaaatcttgggca
agatttgctaaaaggtatttagaacttattgattatcaaggcacttattttttacccatt
tatcatagctttacccccatttatgaatggtatcaccccaatatcaacccctatcaaagg
aacgattttaaattccaaattagttttaaaatgcccgttttcaaacatcttctttggact
aaaggcacattgtttttagcctacacccaaaccaattggtttcaaatctataatgaccca
caatctgctcctatgcgtatggttaattatatgccagagctcatctatgtctatcctatc
aactttgaaccttttggaggtaaaattgggaattttgctgagctatggataggttggcaa
catatctctaatggcgtaggcggggctgcatgctatcaaccctttagccaaggaaagcca
gaaaaccaatttcccggacagcctgttgaagtcaaagattataacggacaaaaaaatgtg
cgttgggggggatgccgttctgtgagtgcaggtcagcgcccggtatttcgcttagtatgg
aaaaagggagggctaaaaattatggttgcctattggccttatatcccatataatcaatct
aatcctaatttaattgattatatgggttatggcaacgctaaaattgattatcggcgtgga
cgccatcattttgaattgcaactttatgatatttttacacaatattggcgctataagcgt
tggcatggagcgtttcgcttgggctatacctatcgcattaatccttatgtggggatttat
gcgcagtggtttaatggttatggtgatggactctatgaatatgatgtctattctaatcgc
ctaggcataggaatacgcctaaacccctaa

DBGET integrated database retrieval system