KEGG   Helicobacter cetorum MIT 00-7128: HCW_04055Help
Entry
HCW_04055         CDS       T02032                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
hce  Helicobacter cetorum MIT 00-7128
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hce00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HCW_04055 (ruvA)
Enzymes [BR:hce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     HCW_04055 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
865572..866123
Genome map
AA seq 183 aa AA seqDB search
MIVGLKGIVEKISALEVHMEVHGVIYGVQVSMRTSAALKLNQETHLKILQVIKEDAHLLY
GFLEEAEKILFERLLKINGVGGRIALAILSSFAPSEFENIIASKEVKALQQVPGIGKKLA
DKIMVDLIGFFIQDETKPTYNEAFLALESLGFKNTEINKVLKTLQPNLSTEMAIKEALQR
LRS
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
gtgattgtaggtttaaaaggcattgtagaaaaaatttcagccctagaagtgcatatggaa
gtgcatggggttatttatggggtgcaagtttctatgcgcacaagtgccgcattaaaactc
aatcaagaaacacatttaaaaatcttgcaagtgattaaagaagacgctcatcttttatac
ggatttttagaagaggcagaaaaaattctttttgaaaggcttttaaaaattaatggggta
ggggggcgaatcgcactagctattctttcaagctttgcgcctagtgaatttgaaaatatt
attgcctctaaagaggttaaagccctccagcaagttcccggaattggcaagaaacttgct
gataagattatggtagatttaattggcttttttattcaagatgagactaagcctacttat
aatgaggcatttttggctttagagagtttagggtttaaaaacacagagattaataaggtt
ttaaaaactcttcagccaaatcttagcactgaaatggcaatcaaagaggctttacagcgc
ttacgctcctaa

DBGET integrated database retrieval system