KEGG   Helicobacter cetorum MIT 00-7128: HCW_04705Help
Entry
HCW_04705         CDS       T02032                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase subunit GalU
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hce  Helicobacter cetorum MIT 00-7128
Pathway
hce00040  Pentose and glucuronate interconversions
hce00052  Galactose metabolism
hce00500  Starch and sucrose metabolism
hce00520  Amino sugar and nucleotide sugar metabolism
hce01100  Metabolic pathways
hce01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hce00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HCW_04705
   00052 Galactose metabolism
    HCW_04705
   00500 Starch and sucrose metabolism
    HCW_04705
   00520 Amino sugar and nucleotide sugar metabolism
    HCW_04705
Enzymes [BR:hce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HCW_04705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFI04208
UniProt: I0EMN9
Position
complement(1015971..1016792)
Genome map
AA seq 273 aa AA seqDB search
MIKKCLFPAAGYGTRFLPITKTIPKEMLPIIDKPLMQYAVEEAMEAGCEVMAIVTGRGKR
SLEDYFDTSYELEHQIQGTSKENALESIRNIMKKCRFSYTRQKQMKGLGHAILTGETLIG
NEPFAVILADDLCASHSNPAVLKQMSELYKKYQCSIVAIEEVALEEVSKYGVIKGELLEE
GVYEIKDMVEKPNQEDAPSNLAVIGRYILTPDIFDILRITKPGKNNEIQITDALLTQAKQ
KRIIAYKFKGKRYDCGSVEGYIEATNAYYQQRL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgtctttttcctgctgctggttatggcacacgctttttacccattact
aaaactatccccaaagaaatgctccccattatagacaaacccctaatgcaatatgctgta
gaagaggctatggaggcaggttgtgaggtaatggcaattgttacaggacgaggcaaacgc
agtttggaagactattttgatacaagctatgagttagaacatcaaatccaaggcacaagc
aaggaaaatgccctagaaagcattcgtaatattatgaaaaaatgccgtttttcttataca
cgccaaaagcaaatgaaaggtctagggcatgcgattttaaccggtgaaaccctcataggc
aatgagccttttgcagtgattttagccgatgatttatgtgctagtcatagtaatcctgct
gttttaaaacaaatgagcgaactttataaaaaatatcaatgctctattgtggctattgaa
gaagtagcgttagaagaggtttcaaaatacggcgtgattaagggcgaattactagaagaa
ggcgtgtatgagataaaagatatggttgaaaaacctaaccaagaagatgccccaagcaat
ttagctgtcataggacgctatattctaacccctgatatttttgatattttgcgtattact
aaacccggcaaaaataatgaaatccaaattacagacgctcttttaactcaagctaaacaa
aaacgcattattgcctataaattcaaaggtaagcgttatgattgtgggagtgttgagggc
tatattgaggcaactaatgcctattatcaacaacgcttataa

DBGET integrated database retrieval system