KEGG   Helicobacter cetorum MIT 00-7128: HCW_04705Help
Entry
HCW_04705         CDS       T02032                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase subunit GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hce  Helicobacter cetorum MIT 00-7128
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hce00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HCW_04705
   00052 Galactose metabolism
    HCW_04705
   00500 Starch and sucrose metabolism
    HCW_04705
   00520 Amino sugar and nucleotide sugar metabolism
    HCW_04705
Enzymes [BR:hce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HCW_04705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1015971..1016792)
Genome map
AA seq 273 aa AA seqDB search
MIKKCLFPAAGYGTRFLPITKTIPKEMLPIIDKPLMQYAVEEAMEAGCEVMAIVTGRGKR
SLEDYFDTSYELEHQIQGTSKENALESIRNIMKKCRFSYTRQKQMKGLGHAILTGETLIG
NEPFAVILADDLCASHSNPAVLKQMSELYKKYQCSIVAIEEVALEEVSKYGVIKGELLEE
GVYEIKDMVEKPNQEDAPSNLAVIGRYILTPDIFDILRITKPGKNNEIQITDALLTQAKQ
KRIIAYKFKGKRYDCGSVEGYIEATNAYYQQRL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgtctttttcctgctgctggttatggcacacgctttttacccattact
aaaactatccccaaagaaatgctccccattatagacaaacccctaatgcaatatgctgta
gaagaggctatggaggcaggttgtgaggtaatggcaattgttacaggacgaggcaaacgc
agtttggaagactattttgatacaagctatgagttagaacatcaaatccaaggcacaagc
aaggaaaatgccctagaaagcattcgtaatattatgaaaaaatgccgtttttcttataca
cgccaaaagcaaatgaaaggtctagggcatgcgattttaaccggtgaaaccctcataggc
aatgagccttttgcagtgattttagccgatgatttatgtgctagtcatagtaatcctgct
gttttaaaacaaatgagcgaactttataaaaaatatcaatgctctattgtggctattgaa
gaagtagcgttagaagaggtttcaaaatacggcgtgattaagggcgaattactagaagaa
ggcgtgtatgagataaaagatatggttgaaaaacctaaccaagaagatgccccaagcaat
ttagctgtcataggacgctatattctaacccctgatatttttgatattttgcgtattact
aaacccggcaaaaataatgaaatccaaattacagacgctcttttaactcaagctaaacaa
aaacgcattattgcctataaattcaaaggtaagcgttatgattgtgggagtgttgagggc
tatattgaggcaactaatgcctattatcaacaacgcttataa

DBGET integrated database retrieval system